Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01193
Secondary Accession Numbers
  • 6489
Name Phosphorylase b kinase gamma catalytic chain, skeletal muscle isoform
Synonyms
  1. Phosphorylase kinase subunit gamma-1
Gene Name PHKG1
Protein Type Enzyme
Biological Properties
General Function Involved in phosphorylase kinase activity
Specific Function Phosphorylase b kinase catalyzes the phosphorylation of serine in certain substrates, including troponin I
Pathways Not Available
Reactions Not Available
GO Classification
Component
phosphorylase kinase complex
macromolecular complex
protein complex
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
phosphorylase kinase activity
calmodulin binding
protein binding
protein kinase activity
protein serine/threonine kinase activity
calmodulin-dependent protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
glycogen metabolic process
glycogen biosynthetic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:7
Locus 7p11.2
SNPs PHKG1
Gene Sequence
>1164 bp
ATGACCCGGGACGAGGCACTGCCGGACTCTCATTCTGCACAGGACTTCTATGAGAATTAT
GAGCCCAAAGAGATCCTGGGCAGGGGCGTTAGCAGTGTGGTCAGGCGATGCATCCACAAG
CCCACGAGCCAGGAGTACGCCGTGAAGGTCATCGACGTCACCGGTGGAGGCAGCTTCAGC
CCGGAGGAGGTGCGGGAGCTGCGAGAAGCCACGCTGAAGGAGGTGGACATCCTGCGCAAG
GTCTCAGGGCACCCCAACATCATACAGCTGAAGGACACTTATGAGACCAACACTTTCTTC
TTCTTGGTGTTTGACCTGATGAAGAGAGGGGAGCTCTTTGACTACCTCACTGAGAAGGTC
ACCTTGAGTGAGAAGGAAACCAGAAAGATCATGCGAGCTCTGCTGGAGGTGATCTGCACC
TTGCACAAACTCAACATCGTGCACCGGGACCTGAAGCCCGAGAACATTCTCTTGGATGAC
AACATGAACATCAAGCTCACAGACTTTGGCTTTTCCTGCCAGCTGGAGCCGGGAGAGAGG
CTGCGAGAGGTCTGCGGGACCCCCAGTTACCTGGCCCCTGAGATTATCGAGTGCTCCATG
AATGAGGACCACCCGGGCTACGGGAAAGAGGTGGACATGTGGAGCACTGGCGTCATCATG
TACACGCTGCTGGCCGGCTCCCCGCCCTTCTGGCACCGGAAGCAGATGCTGATGCTGAGG
ATGATCATGAGCGGCAACTACCAGTTTGGCTCGCCCGAGTGGGATGATTACTCGGACACC
GTGAAGGACCTGGTCTCCCGATTCCTGGTGGTGCAACCCCAGAACCGCTACACAGCGGAA
GAGGCCTTGGCACACCCCTTCTTCCAGCAGTACTTGGTGGAGGAAGTGCGGCACTTCAGC
CCCCGGGGGAAGTTCAAGGTGATCGCTCTGACCGTGCTGGCTTCAGTGCGGATCTACTAC
CAGTACCGCCGGGTGAAGCCTGTGACCCGGGAGATCGTCATCCGAGACCCCTATGCCCTC
CGGCCTCTGCGCCGGCTCATCGACGCCTACGCTTTCCGAATCTATGGCCACTGGGTGAAG
AAGGGGCAGCAGCAGAACCGGGCAGCCCTTTTCGAGAACACACCCAAGGCCGTGCTCCTC
TCCCTGGCCGAGGAGGACTACTGA
Protein Properties
Number of Residues 387
Molecular Weight 45023.4
Theoretical pI 6.86
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Phosphorylase b kinase gamma catalytic chain, skeletal muscle isoform
MTRDEALPDSHSAQDFYENYEPKEILGRGVSSVVRRCIHKPTSQEYAVKVIDVTGGGSFS
PEEVRELREATLKEVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKV
TLSEKETRKIMRALLEVICTLHKLNIVHRDLKPENILLDDNMNIKLTDFGFSCQLEPGER
LREVCGTPSYLAPEIIECSMNEDHPGYGKEVDMWSTGVIMYTLLAGSPPFWHRKQMLMLR
MIMSGNYQFGSPEWDDYSDTVKDLVSRFLVVQPQNRYTAEEALAHPFFQQYLVEEVRHFS
PRGKFKVIALTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAYAFRIYGHWVK
KGQQQNRAALFENTPKAVLLSLAEEDY
GenBank ID Protein 17224425
UniProtKB/Swiss-Prot ID Q16816
UniProtKB/Swiss-Prot Entry Name PHKG1_HUMAN
PDB IDs
GenBank Gene ID AF254253
GeneCard ID PHKG1
GenAtlas ID PHKG1
HGNC ID HGNC:8930
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  3. Wehner M, Kilimann MW: Human cDNA encoding the muscle isoform of the phosphorylase kinase gamma subunit (PHKG1). Hum Genet. 1995 Nov;96(5):616-8. [PubMed:8530014 ]