You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01198
Secondary Accession Numbers
  • 6494
Name Serine/threonine-protein kinase N2
Synonyms
  1. Protein kinase C-like 2
  2. Protein-kinase C-related kinase 2
Gene Name PKN2
Protein Type Enzyme
Biological Properties
General Function Involved in protein serine/threonine kinase activity
Specific Function Exhibits a preference for highly basic protein substrates
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
biological regulation
regulation of biological process
cellular metabolic process
regulation of cellular process
signal transduction
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 1p22.2
SNPs PKN2
Gene Sequence
>2955 bp
ATGGCGTCCAACCCCGAACGGGGGGAGATTCTGCTCACGGAACTGCAGGGGGATTCCCGA
AGTCTTCCGTTTTCTGAGAATGTGAGTGCTGTTCAAAAATTAGACTTTTCAGATACAATG
GTGCAGCAGAAATTGGATGATATCAAGGATCGAATTAAGAGAGAAATAAGGAAAGAACTG
AAAATCAAAGAAGGAGCTGAAAATCTGAGGAAAGTCACAACAGATAAAAAAAGTTTGGCT
TATGTAGACAACATTTTGAAAAAATCAAATAAAAAATTAGAAGAACTACATCACAAGCTG
CAGGAATTAAATGCACATATTGTTGTATCAGATCCAGAAGATATTACAGATTGCCCAAGG
ACTCCAGATACTCCAAATAATGACCCTCGTTGTTCTACTAGCAACAATAGATTGAAGGCC
TTACAAAAACAATTGGATATAGAACTTAAAGTAAAACAAGGTGCAGAGAATATGATACAG
ATGTATTCAAATGGATCTTCAAAGGATCGGAAACTCCATGGTACAGCTCAGCAACTGCTC
CAGGACAGCAAGACAAAAATAGAAGTCATACGAATGCAGATTCTTCAGGCAGTCCAGACT
AATGAATTGGCTTTTGATAATGCAAAACCTGTGATAAGTCCTCTTGAACTTCGGATGGAA
GAATTAAGGCATCATTTTAGGATAGAGTTTGCAGTAGCAGAAGGTGCAAAGAATGTAATG
AAATTACTTGGCTCAGGAAAAGTAACAGACAGAAAAGCACTTTCAGAAGCTCAAGCAAGA
TTTAATGAATCAAGTCAGAAGTTGGACCTTTTAAAGTATTCATTAGAGCAAAGATTAAAC
GAAGTCCCCAAGAATCATCCCAAAAGCAGGATTATTATTGAAGAACTTTCACTTGTTGCT
GCATCACCAACACTAAGTCCACGTCAAAGTATGATATCTACGCAAAATCAATATAGTACA
CTATCCAAACCAGCAGCACTAACAGGTACTTTGGAAGTTCGTCTTATGGGCTGCCAAGAT
ATCCTAGAGAATGTCCCTGGACGGTCAAAAGCAACATCAGTTGCACTGCCTGGTTGGAGT
CCAAGTGAAACCAGATCATCTTTCATGAGCAGAACGAGTAAAAGTAAAAGCGGAAGTAGT
CGAAATCTTCTAAAAACCGATGACTTGTCCAATGATGTCTGTGCTGTTTTGAAGCTCGAT
AATACTGTGGTTGGCCAAACTAGCTGGAAACCCATTTCCAATCAGTCATGGGACCAGAAG
TTTACACTGGAACTGGACAGGTCACGTGAACTGGAAATTTCAGTTTATTGGCGTGATTGG
CGGTCTCTGTGTGCTGTAAAATTTCTGAGGTTAGAAGATTTTTTAGACAACCAACGGCAT
GGCATGTGTCTCTATTTGGAACCACAGGGTACTTTATTTGCAGAGGTTACCTTTTTTAAT
CCAGTTATTGAAAGAAGACCAAAACTTCAAAGACAAAAGAAAATTTTTTCAAAGCAACAA
GGCAAAACATTTCTCAGAGCTCCTCAAATGAATATTAATATTGCCACTTGGGGAAGGCTA
GTAAGAAGAGCTATTCCTACAGTAAATCATTCTGGCACCTTCAGCCCTCAAGCTCCTGTG
CCTACTACAGTGCCAGTGGTTGATGTACGCATCCCTCAACTAGCACCTCCAGCTAGTGAT
TCTACAGTAACCAAATTGGACTTTGATCTTGAGCCTGAACCTCCTCCAGCCCCACCACGA
GCTTCTTCTCTTGGAGAAATAGATGAATCTTCTGAATTAAGAGTTTTGGATATACCAGGA
CAGGATTCAGAGACTGTTTTTGATATTCAGAATGACAGAAATAGTATACTTCCAAAATCT
CAATCTGAATACAAGCCTGATACTCCTCAGTCAGGCCTAGAATATAGTGGTATTCAAGAA
CTTGAGGACAGAAGATCTCAGCAAAGGTTTCAGTTTAATCTACAAGATTTCAGGTGTTGT
GCTGTCTTGGGAAGAGGACATTTTGGAAAGGTGCTTTTAGCTGAATATAAAAACACAAAT
GAGATGTTTGCTATAAAAGCCTTAAAGAAAGGAGATATTGTGGCTCGAGATGAAGTAGAC
AGCCTGATGTGTGAAAAAAGAATTTTTGAAACTGTGAATAGTGTAAGGCATCCCTTTTTG
GTGAACCTTTTTGCATGTTTCCAAACCAAAGAGCATGTTTGCTTTGTAATGGAATATGCT
GCCGGTGGGGACCTAATGATGCACATTCATACTGATGTCTTTTCTGAACCAAGAGCTGTA
TTTTATGCTGCTTGTGTAGTTCTTGGGTTGCAGTATTTACATGAACACAAAATTGTTTAT
AGAGATTTGAAATTGGATAACTTATTGCTAGATACAGAGGGCTTTGTGAAAATTGCTGAT
TTTGGTCTTTGCAAAGAAGGAATGGGATATGGAGATAGAACAAGCACATTTTGTGGCACT
CCTGAATTTCTTGCCCCAGAAGTATTAACAGAAACTTCTTATACAAGGGCTGTAGATTGG
TGGGGCCTTGGCGTGCTTATATATGAAATGCTTGTTGGTGAGTCTCCCTTTCCTGGTGAT
GATGAAGAGGAAGTTTTTGACAGTATTGTAAATGATGAAGTAAGGTATCCAAGGTTCTTA
TCTACAGAAGCCATTTCTATAATGAGAAGGCTGTTAAGAAGAAATCCTGAACGGCGCCTT
GGGGCTAGCGAGAAAGATGCAGAGGATGTAAAAAAGCACCCATTTTTCCGGCTAATTGAT
TGGAGCGCTCTGATGGACAAAAAAGTAAAGCCACCATTTATACCTACCATAAGAGGACGA
GAAGATGTTAGTAATTTTGATGATGAATTTACCTCAGAAGCACCTATTCTGACTCCACCT
CGAGAACCAAGGATACTTTCGGAAGAGGAGCAGGAAATGTTCAGAGATTTTGACTACATT
GCTGATTGGTGTTAA
Protein Properties
Number of Residues 984
Molecular Weight 112033.5
Theoretical pI 6.22
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Serine/threonine-protein kinase N2
MASNPERGEILLTELQGDSRSLPFSENVSAVQKLDFSDTMVQQKLDDIKDRIKREIRKEL
KIKEGAENLRKVTTDKKSLAYVDNILKKSNKKLEELHHKLQELNAHIVVSDPEDITDCPR
TPDTPNNDPRCSTSNNRLKALQKQLDIELKVKQGAENMIQMYSNGSSKDRKLHGTAQQLL
QDSKTKIEVIRMQILQAVQTNELAFDNAKPVISPLELRMEELRHHFRIEFAVAEGAKNVM
KLLGSGKVTDRKALSEAQARFNESSQKLDLLKYSLEQRLNEVPKNHPKSRIIIEELSLVA
ASPTLSPRQSMISTQNQYSTLSKPAALTGTLEVRLMGCQDILENVPGRSKATSVALPGWS
PSETRSSFMSRTSKSKSGSSRNLLKTDDLSNDVCAVLKLDNTVVGQTSWKPISNQSWDQK
FTLELDRSRELEISVYWRDWRSLCAVKFLRLEDFLDNQRHGMCLYLEPQGTLFAEVTFFN
PVIERRPKLQRQKKIFSKQQGKTFLRAPQMNINIATWGRLVRRAIPTVNHSGTFSPQAPV
PTTVPVVDVRIPQLAPPASDSTVTKLDFDLEPEPPPAPPRASSLGEIDESSELRVLDIPG
QDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFRCC
AVLGRGHFGKVLLAEYKNTNEMFAIKALKKGDIVARDEVDSLMCEKRIFETVNSVRHPFL
VNLFACFQTKEHVCFVMEYAAGGDLMMHIHTDVFSEPRAVFYAACVVLGLQYLHEHKIVY
RDLKLDNLLLDTEGFVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTETSYTRAVDW
WGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNPERRL
GASEKDAEDVKKHPFFRLIDWSALMDKKVKPPFIPTIRGREDVSNFDDEFTSEAPILTPP
REPRILSEEEQEMFRDFDYIADWC
GenBank ID Protein 56204512
UniProtKB/Swiss-Prot ID Q16513
UniProtKB/Swiss-Prot Entry Name PKN2_HUMAN
PDB IDs Not Available
GenBank Gene ID AL136381
GeneCard ID PKN2
GenAtlas ID PKN2
HGNC ID HGNC:9406
References
General References
  1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  5. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  7. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  8. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  9. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  10. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  11. Palmer RH, Ridden J, Parker PJ: Identification of multiple, novel, protein kinase C-related gene products. FEBS Lett. 1994 Dec 12;356(1):5-8. [PubMed:7988719 ]
  12. Palmer RH, Ridden J, Parker PJ: Cloning and expression patterns of two members of a novel protein-kinase-C-related kinase family. Eur J Biochem. 1995 Jan 15;227(1-2):344-51. [PubMed:7851406 ]
  13. DeGiorgis JA, Jaffe H, Moreira JE, Carlotti CG Jr, Leite JP, Pant HC, Dosemeci A: Phosphoproteomic analysis of synaptosomes from human cerebral cortex. J Proteome Res. 2005 Mar-Apr;4(2):306-15. [PubMed:15822905 ]