You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01212
Secondary Accession Numbers
  • 6508
Name Wee1-like protein kinase
Synonyms
  1. WEE1hu
  2. Wee1A kinase
Gene Name WEE1
Protein Type Unknown
Biological Properties
General Function Involved in protein kinase activity
Specific Function May act as a negative regulator of entry into mitosis (G2 to M transition) by protecting the nucleus from cytoplasmically activated cyclin B1-complexed CDK1 before the onset of mitosis. Its activity increases during S and G2 phases and decreases at M phase when it is hyperphosphorylated. A correlated decrease in protein level occurs at M/G1 phase, probably due to its degradation. Specifically phosphorylates and inactivates cyclin B1-complexed CDK1 reaching a maximum during G2 phase and a minimum as cells enter M phase. Phosphorylation of cyclin B1-CDK1 occurs exclusively on 'Tyr-15' and phosphorylation of monomeric CDK1 does not occur
Pathways Not Available
Reactions Not Available
GO Classification
Component
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
Function
protein tyrosine kinase activity
non-membrane spanning protein tyrosine kinase activity
ion binding
cation binding
metal ion binding
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
magnesium ion binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
organelle fission
nuclear division
mitosis
cellular process
cellular component organization at cellular level
organelle organization
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:1
Locus 11p15.3-p15.1
SNPs WEE1
Gene Sequence
>1941 bp
ATGAGCTTCCTGAGCCGACAGCAGCCGCCGCCACCCCGCCGCGCCGGGGCGGCCTGCACC
TTGCGGCAGAAGCTGATCTTCTCGCCCTGCAGCGACTGTGAGGAGGAGGAAGAAGAGGAG
GAGGAGGAGGGCAGCGGCCACAGCACCGGGGAGGACTCGGCCTTTCAAGAGCCCGACTCG
CCGCTGCCGCCCGCGCGGAGCCCCACGGAGCCCGGGCCCGAGCGCCGCCGCTCGCCCGGG
CCGGCCCCCGGCAGCCCCGGCGAGCTGGAGGAGGACCTGTTGCTGCCCGGCGCCTGCCCG
GGCGCGGACGAGGCGGGCGGTGGGGCGGAGGGCGACTCGTGGGAGGAGGAGGGCTTCGGC
TCCTCGTCGCCGGTCAAGTCGCCGGCGGCCCCCTACTTCCTGGGTAGCTCTTTCTCGCCG
GTGCGCTGCGGCGGCCCAGGAGATGCGTCGCCGCGGGGTTGCGGGGCGCGCCGGGCGGGC
GAAGGCCGCCGCTCGCCGCGGCCGGACCACCCGGGCACCCCGCCACACAAGACCTTCCGC
AAGCTGCGACTCTTCGACACCCCGCACACGCCCAAGAGTTTGCTCTCCAAAGCTCGGGGA
ATTGATTCCAGCTCTGTTAAACTCCGGGGTAGTTCTCTCTTCATGGATACAGAAAAATCA
GGAAAAAGGGAATTTGATGTGCGACAGACTCCTCAAGTGAATATTAATCCTTTTACTCCG
GATTCTTTGTTGCTTCATTCCTCAGGACAGTGTCGTCGTAGAAAGAGAACGTATTGGAAT
GATTCCTGTGGTGAAGACATGGAAGCCAGTGATTATGAGCTTGAAGATGAAACAAGACCT
GCTAAGAGAATTACAATTACTGAAAGCAATATGAAGTCCCGGTATACAACAGAATTTCAT
GAGCTAGAGAAAATCGGCTCTGGAGAATTTGGTTCTGTATTTAAGTGTGTGAAGAGGCTG
GATGGATGCATTTATGCCATTAAGCGATCAAAAAAGCCATTGGCGGGCTCTGTTGATGAG
CAGAACGCTTTGAGAGAAGTATATGCTCATGCAGTGCTTGGACAGCATTCTCATGTAGTT
CGATATTTCTCTGCGTGGGCAGAAGATGATCATATGCTTATACAGAATGAATATTGTAAT
GGTGGAAGTTTAGCTGATGCTATAAGTGAAAACTACAGAATCATGAGTTACTTTAAAGAA
GCAGAGTTGAAGGATCTCCTTTTGCAAGTTGGCCGAGGCTTGAGGTATATTCATTCAATG
TCTTTGGTTCACATGGATATAAAACCTAGTAATATTTTCATATCTCGAACCTCAATCCCA
AATGCTGCCTCTGAAGAAGGAGACGAAGATGATTGGGCATCCAACAAAGTTATGTTTAAA
ATAGGTGATCTTGGGCATGTAACAAGGATCTCCAGTCCACAAGTTGAAGAGGGCGATAGT
CGTTTTCTTGCAAATGAAGTTTTACAGGAGAATTATACCCATCTACCAAAAGCAGATATT
TTTGCGCTTGCCCTCACAGTGGTATGTGCTGCTGGTGCTGAACCTCTTCCGAGAAATGGA
GATCAATGGCATGAAATCAGACAGGGTAGATTACCTCGGATACCACAAGTGCTTTCCCAA
GAATTTACAGAGTTGCTAAAAGTTATGATTCATCCAGATCCAGAGAGAAGACCTTCAGCA
ATGGCACTGGTAAAGCATTCAGTATTGCTGTCCGCTTCTAGAAAGAGTGCAGAACAATTA
CGAATAGAATTGAATGCCGAAAAGTTCAAAAATTCACTTTTACAAAAAGAACTCAAGAAA
GCACAGATGGCAAAAGCTGCAGCTGAGGAAAGAGCACTCTTCACTGACCGGATGGCCACT
AGGTCCACCACCCAGAGTAATAGAACATCTCGACTTATTGGAAAGAAAATGAACCGCTCT
GTCAGCCTTACTATATACTGA
Protein Properties
Number of Residues 646
Molecular Weight 71596.7
Theoretical pI 6.76
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Wee1-like protein kinase
MSFLSRQQPPPPRRAGAACTLRQKLIFSPCSDCEEEEEEEEEEGSGHSTGEDSAFQEPDS
PLPPARSPTEPGPERRRSPGPAPGSPGELEEDLLLPGACPGADEAGGGAEGDSWEEEGFG
SSSPVKSPAAPYFLGSSFSPVRCGGPGDASPRGCGARRAGEGRRSPRPDHPGTPPHKTFR
KLRLFDTPHTPKSLLSKARGIDSSSVKLRGSSLFMDTEKSGKREFDVRQTPQVNINPFTP
DSLLLHSSGQCRRRKRTYWNDSCGEDMEASDYELEDETRPAKRITITESNMKSRYTTEFH
ELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVV
RYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSM
SLVHMDIKPSNIFISRTSIPNAASEEGDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDS
RFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQ
EFTELLKVMIHPDPERRPSAMALVKHSVLLSASRKSAEQLRIELNAEKFKNSLLQKELKK
AQMAKAAAEERALFTDRMATRSTTQSNRTSRLIGKKMNRSVSLTIY
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P30291
UniProtKB/Swiss-Prot Entry Name WEE1_HUMAN
PDB IDs Not Available
GenBank Gene ID U10564
GeneCard ID WEE1
GenAtlas ID WEE1
HGNC ID HGNC:12761
References
General References
  1. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  2. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  3. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  4. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  5. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  6. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  7. Wissing J, Jansch L, Nimtz M, Dieterich G, Hornberger R, Keri G, Wehland J, Daub H: Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry. Mol Cell Proteomics. 2007 Mar;6(3):537-47. Epub 2006 Dec 27. [PubMed:17192257 ]
  8. Watanabe N, Broome M, Hunter T: Regulation of the human WEE1Hu CDK tyrosine 15-kinase during the cell cycle. EMBO J. 1995 May 1;14(9):1878-91. [PubMed:7743995 ]
  9. Cichutek A, Brueckmann T, Seipel B, Hauser H, Schlaubitz S, Prawitt D, Hankeln T, Schmidt ER, Winterpacht A, Zabel BU: Comparative architectural aspects of regions of conserved synteny on human chromosome 11p15.3 and mouse chromosome 7 (including genes WEE1 and LMO1). Cytogenet Cell Genet. 2001;93(3-4):277-83. [PubMed:11528126 ]
  10. Igarashi M, Nagata A, Jinno S, Suto K, Okayama H: Wee1(+)-like gene in human cells. Nature. 1991 Sep 5;353(6339):80-3. [PubMed:1840647 ]
  11. McGowan CH, Russell P: Human Wee1 kinase inhibits cell division by phosphorylating p34cdc2 exclusively on Tyr15. EMBO J. 1993 Jan;12(1):75-85. [PubMed:8428596 ]
  12. Lu R, Niida H, Nakanishi M: Human SAD1 kinase is involved in UV-induced DNA damage checkpoint function. J Biol Chem. 2004 Jul 23;279(30):31164-70. Epub 2004 May 18. [PubMed:15150265 ]
  13. Squire CJ, Dickson JM, Ivanovic I, Baker EN: Structure and inhibition of the human cell cycle checkpoint kinase, Wee1A kinase: an atypical tyrosine kinase with a key role in CDK1 regulation. Structure. 2005 Apr;13(4):541-50. [PubMed:15837193 ]