You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01266
Secondary Accession Numbers
  • 6562
Name Serine/threonine-protein kinase 10
Synonyms
  1. Lymphocyte-oriented kinase
Gene Name STK10
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase activity
Specific Function Can act on substrates such as myelin basic protein and histone 2A on serine and threonine residues
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:5
Locus 5q35.1
SNPs STK10
Gene Sequence
>2907 bp
ATGGCTTTTGCCAATTTCCGCCGCATCCTGCGCCTGTCTACCTTCGAGAAGAGAAAGTCC
CGCGAATATGAGCACGTCCGCCGCGACCTGGACCCCAACGAGGTGTGGGAGATCGTGGGC
GAGCTGGGCGACGGCGCCTTCGGCAAGGTTTACAAGGCCAAGAATAAGGAGACGGGTGCT
TTGGCTGCGGCCAAAGTCATTGAAACCAAGAGTGAGGAGGAGCTGGAGGACTACATCGTG
GAGATTGAGATCCTGGCCACCTGCGACCACCCCTACATTGTGAAGCTCCTGGGAGCCTAC
TATCACGACGGGAAGCTGTGGATCATGATTGAGTTCTGTCCAGGGGGAGCCGTGGACGCC
ATCATGCTGGAGCTGGACAGAGGCCTCACGGAGCCCCAGATACAGGTGGTTTGCCGCCAG
ATGCTAGAAGCCCTCAACTTCCTGCACAGCAAGAGGATCATCCACCGAGATCTGAAAGCT
GGCAACGTGCTGATGACCCTCGAGGGAGACATCAGGCTGGCTGACTTTGGTGTGTCTGCC
AAGAATCTGAAGACTCTACAGAAACGAGATTCCTTCATCGGCACGCCTTACTGGATGGCC
CCCGAGGTGGTCATGTGTGAGACCATGAAAGACACGCCCTACGACTACAAAGCCGACATC
TGGTCCCTGGGCATCACGCTGATTGAGATGGCCCAGATCGAGCCGCCACACCACGAGCTC
AACCCCATGCGGGTCCTGCTAAAGATCGCCAAGTCAGACCCTCCCACGCTGCTCACGCCC
TCCAAGTGGTCTGTAGAGTTCCGTGACTTCCTGAAGATAGCCCTGGATAAGAACCCAGAA
ACCCGACCCAGTGCCGCGCAGCTGCTGGAGCATCCCTTCGTCAGCAGCATCACCAGTAAC
AAGGCTCTGCGGGAGCTGGTGGCTGAGGCCAAGGCCGAGGTGATGGAAGAGATCGAAGAC
GGCCGGGATGAGGGGGAAGAGGAGGACGCCGTGGATGCCGCCTCCACCCTGGAGAACCAT
ACTCAGAACTCCTCTGAGGTGAGTCCGCCAAGCCTCAATGCTGACAAGCCTCTCGAGGAG
TCACCTTCCACCCCGCTGGCACCCAGCCAGTCTCAGGACAGTGTGAATGAGCCCTGCAGC
CAGCCCTCTGGGGACAGATCCCTCCAAACCACCAGTCCCCCAGTCGTGGCCCCTGGAAAT
GAGAACGGCCTGGCAGTGCCTGTGCCCCTGCGGAAGTCCCGACCCGTGTCAATGGATGCC
AGAATTCAGGTAGCCCAGGAGAAGCAAGTTGCTGAGCAGGGTGGGGACCTCAGCCCAGCA
GCCAACAGATCTCAAAAGGCCAGCCAGAGCCGGCCCAACAGCAGCGCCCTGGAGACCTTG
GGTGGGGAGAAGCTGGCCAATGGCAGCCTGGAGCCACCTGCCCAGGCAGCTCCAGGGCCT
TCCAAGAGGGACTCGGACTGCAGCAGCCTCTGCACCTCTGAGAGCATGGACTATGGTACC
AATCTCTCCACTGACCTGTCGCTGAACAAAGAGATGGGCTCTCTGTCCATCAAGGACCCG
AAACTGTACAAAAAAACCCTCAAGCGGACACGCAAATTTGTGGTGGATGGTGTGGAGGTG
AGCATCACCACCTCCAAGATCATCAGCGAAGATGAGAAGAAGGATGAGGAGATGAGATTT
CTCAGGCGCCAGGAACTCCGAGAGCTTCGGCTGCTCCAGAAAGAAGAGCATCGGAACCAG
ACCCAGCTGAGTAACAAGCATGAGCTGCAGCTGGAGCAAATGCATAAACGTTTTGAACAG
GAAATCAACGCCAAGAAGAAGTTCTTTGACACGGAATTAGAGAACCTGGAGCGTCAGCAA
AAGCAGCAAGTGGAGAAGATGGAGCAAGACCATGCCGTGCGCCGCCGGGAGGAGGCCAGG
CGGATCCGCCTGGAGCAGGATCGGGACTACACCAGGTTCCAAGAGCAGCTCAAACTGATG
AAGAAAGAGGTGAAGAACGAGGTGGAGAAGCTCCCCCGACAGCAGCGGAAGGAAAGCATG
AAGCAGAAGATGGAGGAGCACACGCAGAAAAAGCAGCTTCTTGACCGGGACTTTGTAGCC
AAGCAGAAGGAGGACCTGGAGCTGGCCATGAAGAGGCTCACCACCGACAACAGGCGGGAG
ATCTGTGACAAGGAGCGCGAGTGCCTCATGAAGAAGCAGGAGCTCCTTCGAGACCGGGAA
GCAGCCCTGTGGGAGATGGAAGAGCACCAGCTGCAGGAGAGGCACCAGCTGGTGAAGCAG
CAGCTCAAAGACCAGTACTTCCTCCAGCGGCACGAGCTGCTGCGCAAGCATGAGAAGGAG
CGGGAGCAGATGCAGCGCTACAACCAGCGCATGATAGAGCAGCTGAAGGTGCGGCAGCAA
CAGGAAAAGGCGCGGCTGCCCAAGATCCAGAGGAGTGAGGGCAAGACGCGCATGGCCATG
TACAAGAAGAGCCTCCACATCAACGGCGGGGGCAGCGCAGCTGAGCAGCGTGAGAAGATC
AAGCAGTTCTCCCAGCAGGAGGAGAAGAGGCAGAAGTCGGAGCGGCTGCAGCAACAGCAG
AAACACGAGAACCAGATGCGGGACATGCTGGCGCAGTGTGAGAGCAACATGAGCGAGCTG
CAGCAGCTGCAGAATGAAAAGTGCCACCTCCTGGTAGAGCACGAAACCCAGAAACTGAAG
GCCCTGGATGAGAGCCATAACCAGAACCTGAAGGAATGGCGGGACAAGCTTCGGCCGCGC
AAGAAGGCTCTGGAAGAGGATCTGAACCAGAAGAAGCGGGAGCAGGAGATGTTCTTCAAG
CTGAGCGAGGAGGCGGAGTGCCCAAACCCCTCCACCCCAAGCAAGGCCGCCAAGTTCTTC
CCCTACAGTTCTGCGGATGCTTCTTAA
Protein Properties
Number of Residues 968
Molecular Weight 112134.4
Theoretical pI 6.94
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Serine/threonine-protein kinase 10
MAFANFRRILRLSTFEKRKSREYEHVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGA
LAAAKVIETKSEEELEDYIVEIEILATCDHPYIVKLLGAYYHDGKLWIMIEFCPGGAVDA
IMLELDRGLTEPQIQVVCRQMLEALNFLHSKRIIHRDLKAGNVLMTLEGDIRLADFGVSA
KNLKTLQKRDSFIGTPYWMAPEVVMCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHEL
NPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSN
KALRELVAEAKAEVMEEIEDGRDEGEEEDAVDAASTLENHTQNSSEVSPPSLNADKPLEE
SPSTPLAPSQSQDSVNEPCSQPSGDRSLQTTSPPVVAPGNENGLAVPVPLRKSRPVSMDA
RIQVAQEKQVAEQGGDLSPAANRSQKASQSRPNSSALETLGGEKLANGSLEPPAQAAPGP
SKRDSDCSSLCTSESMDYGTNLSTDLSLNKEMGSLSIKDPKLYKKTLKRTRKFVVDGVEV
SITTSKIISEDEKKDEEMRFLRRQELRELRLLQKEEHRNQTQLSNKHELQLEQMHKRFEQ
EINAKKKFFDTELENLERQQKQQVEKMEQDHAVRRREEARRIRLEQDRDYTRFQEQLKLM
KKEVKNEVEKLPRQQRKESMKQKMEEHTQKKQLLDRDFVAKQKEDLELAMKRLTTDNRRE
ICDKERECLMKKQELLRDREAALWEMEEHQLQERHQLVKQQLKDQYFLQRHELLRKHEKE
REQMQRYNQRMIEQLKVRQQQEKARLPKIQRSEGKTRMAMYKKSLHINGGGSAAEQREKI
KQFSQQEEKRQKSERLQQQQKHENQMRDMLAQCESNMSELQQLQNEKCHLLVEHETQKLK
ALDESHNQNLKEWRDKLRPRKKALEEDLNQKKREQEMFFKLSEEAECPNPSTPSKAAKFF
PYSSADAS
GenBank ID Protein 4001688
UniProtKB/Swiss-Prot ID O94804
UniProtKB/Swiss-Prot Entry Name STK10_HUMAN
PDB IDs Not Available
GenBank Gene ID AB015718
GeneCard ID STK10
GenAtlas ID STK10
HGNC ID HGNC:11388
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  5. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  6. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  7. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  8. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  9. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  10. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  11. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. [PubMed:15372022 ]
  12. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  13. Wissing J, Jansch L, Nimtz M, Dieterich G, Hornberger R, Keri G, Wehland J, Daub H: Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry. Mol Cell Proteomics. 2007 Mar;6(3):537-47. Epub 2006 Dec 27. [PubMed:17192257 ]
  14. Kuramochi S, Matsuda Y, Okamoto M, Kitamura F, Yonekawa H, Karasuyama H: Molecular cloning of the human gene STK10 encoding lymphocyte-oriented kinase, and comparative chromosomal mapping of the human, mouse, and rat homologues. Immunogenetics. 1999 May;49(5):369-75. [PubMed:10199912 ]
  15. Carrascal M, Ovelleiro D, Casas V, Gay M, Abian J: Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment. J Proteome Res. 2008 Dec;7(12):5167-76. [PubMed:19367720 ]
  16. Bignell G, Smith R, Hunter C, Stephens P, Davies H, Greenman C, Teague J, Butler A, Edkins S, Stevens C, O'Meara S, Parker A, Avis T, Barthorpe S, Brackenbury L, Buck G, Clements J, Cole J, Dicks E, Edwards K, Forbes S, Gorton M, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jones D, Kosmidou V, Laman R, Lugg R, Menzies A, Perry J, Petty R, Raine K, Shepherd R, Small A, Solomon H, Stephens Y, Tofts C, Varian J, Webb A, West S, Widaa S, Yates A, Gillis AJ, Stoop HJ, van Gurp RJ, Oosterhuis JW, Looijenga LH, Futreal PA, Wooster R, Stratton MR: Sequence analysis of the protein kinase gene family in human testicular germ-cell tumors of adolescents and adults. Genes Chromosomes Cancer. 2006 Jan;45(1):42-6. [PubMed:16175573 ]