You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01269
Secondary Accession Numbers
  • 6565
  • HMDBP09505
Name NUAK family SNF1-like kinase 1
Synonyms
  1. AMPK-related protein kinase 5
Gene Name NUAK1
Protein Type Unknown
Biological Properties
General Function Involved in protein kinase activity
Specific Function Involved in tolerance to glucose starvation. Phosphorylates ATM. Suppresses Fas-induced apoptosis by phosphorylation of CASP6, thus suppressing the activation of the caspase and the subsequent cleavage of CFLAR
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 12q23.3
SNPs NUAK1
Gene Sequence
>1986 bp
ATGGAAGGGGCCGCCGCGCCTGTGGCGGGGGACCGCCCCGACTTGGGGCTGGGGGCGCCG
GGCTCTCCCCGAGAGGCGGTGGCGGGGGCGACTGCAGCCCTGGAGCCCAGGAAGCCGCAC
GGGGTGAAGCGGCATCACCACAAGCACAACTTGAAGCACCGCTACGAGCTGCAGGAGACC
CTGGGCAAAGGCACCTACGGCAAAGTCAAGCGGGCCACCGAGAGGTTTTCTGGCCGAGTG
GTTGCTATAAAATCCATTCGTAAGGACAAAATTAAGGATGAACAAGACATGGTTCACATC
AGACGAGAGATTGAGATCATGTCATCTCTCAACCATCCTCATATCATCAGTATTTATGAA
GTGTTTGAGAACAAAGATAAGATTGTGATCATCATGGAATATGCCAGCAAAGGGGAGCTG
TACGATTACATCAGTGAGCGGCGACGCCTCAGTGAGAGGGAGACCCGGCACTTCTTCCGG
CAGATCGTCTCTGCTGTGCACTATTGTCACAAGAACGGTGTGGTCCACCGGGACTTGAAG
CTGGAAAATATACTGCTCGATGACAACTGCAATATTAAGATTGCTGACTTTGGGCTTTCC
AACCTGTACCAGAAGGATAAGTTCTTACAAACGTTTTGTGGGAGTCCACTCTATGCATCT
CCTGAGATTGTCAATGGGAGACCTTACCGAGGGCCAGAGGTGGACAGCTGGGCCCTGGGT
GTGTTGCTTTACACTCTTGTTTATGGAACAATGCCCTTCGATGGTTTCGATCACAAAAAC
CTCATTCGGCAAATCAGCAGCGGAGAGTACCGGGAGCCAACACAGCCCTCAGATGCTCGA
GGACTCATACGGTGGATGCTGATGGTGAACCCCGATCGCCGGGCCACTATTGAGGACATT
GCCAACCACTGGTGGGTGAACTGGGGCTATAAGAGCAGCGTGTGTGACTGTGATGCCCTC
CATGACTCTGAGTCCCCACTCCTGGCTCGGATCATTGACTGGCACCACCGTTCCACAGGG
CTGCAGGCTGACACCGAAGCCAAAATGAAGGGCCTGGCCAAACCCACGACCTCTGAGGTC
ATGCTAGAGCGGCAGCGGTCGCTGAAGAAATCCAAGAAAGAGAATGACTTTGCTCAGTCT
GGTCAGGATGCAGTGCCTGAAAGCCCATCCAAGTTGAGTTCTAAGAGGCCCAAGGGGATC
CTGAAGAAGCGAAGCAACAGCGAGCATCGCTCTCACAGCACTGGCTTCATTGAAGGTGTA
GTTGGTCCTGCCTTACCCTCTACTTTCAAGATGGAGCAGGACTTGTGCAGGACTGGCGTG
CTCCTCCCAAGCTCACCAGAGGCAGAGGTGCCGGGAAAACTCAGCCCCAAGCAGTCGGCC
ACGATGCCCAAGAAAGGCATCTTGAAAAAGACCCAGCAGAGAGAATCAGGTTACTACTCT
TCCCCAGAGCGCAGTGAGTCTTCGGAGCTGTTGGACAGTAATGATGTGATGGGCAGCAGC
ATCCCCTCCCCCAGCCCCCCGGACCCAGCCAGGGTAACCTCCCACAGCCTCTCCTGCCGG
AGGAAGGGCATCTTGAAACACAGCAGCAAATACTCAGCGGGCACCATGGACCCAGCCCTG
GTCAGCCCTGAAATGCCCACACTGGAATCCCTGTCAGAGCCTGGTGTCCCTGCCGAGGGC
CTCTCCCGGAGCTACAGCCGCCCTTCCAGTGTCATCAGCGATGACAGCGTGCTGTCCAGC
GACTCTTTTGACTTGCTGGATTTGCAGGAGAATCGCCCTGCCCGCCAGCGCATCCGCAGC
TGCGTCTCTGCAGAAAACTTCCTCCAGATCCAGGACTTTGAGGGGCTCCAGAACCGGCCC
CGGCCCCAGTACCTGAAGCGGTACCGGAACCGGCTGGCAGACAGCAGCTTCTCCCTCCTC
ACAGACATGGATGATGTGACTCAGGTCTACAAGCAAGCGCTGGAGATCTGCAGCAAGCTC
AACTAG
Protein Properties
Number of Residues 661
Molecular Weight 74304.5
Theoretical pI 9.13
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>NUAK family SNF1-like kinase 1
MEGAAAPVAGDRPDLGLGAPGSPREAVAGATAALEPRKPHGVKRHHHKHNLKHRYELQET
LGKGTYGKVKRATERFSGRVVAIKSIRKDKIKDEQDMVHIRREIEIMSSLNHPHIISIYE
VFENKDKIVIIMEYASKGELYDYISERRRLSERETRHFFRQIVSAVHYCHKNGVVHRDLK
LENILLDDNCNIKIADFGLSNLYQKDKFLQTFCGSPLYASPEIVNGRPYRGPEVDSWALG
VLLYTLVYGTMPFDGFDHKNLIRQISSGEYREPTQPSDARGLIRWMLMVNPDRRATIEDI
ANHWWVNWGYKSSVCDCDALHDSESPLLARIIDWHHRSTGLQADTEAKMKGLAKPTTSEV
MLERQRSLKKSKKENDFAQSGQDAVPESPSKLSSKRPKGILKKRSNSEHRSHSTGFIEGV
VGPALPSTFKMEQDLCRTGVLLPSSPEAEVPGKLSPKQSATMPKKGILKKTQQRESGYYS
SPERSESSELLDSNDVMGSSIPSPSPPDPARVTSHSLSCRRKGILKHSSKYSAGTMDPAL
VSPEMPTLESLSEPGVPAEGLSRSYSRPSSVISDDSVLSSDSFDLLDLQENRPARQRIRS
CVSAENFLQIQDFEGLQNRPRPQYLKRYRNRLADSSFSLLTDMDDVTQVYKQALEICSKL
N
GenBank ID Protein 7662170
UniProtKB/Swiss-Prot ID O60285
UniProtKB/Swiss-Prot Entry Name NUAK1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_014840.2
GeneCard ID NUAK1
GenAtlas ID NUAK1
HGNC ID HGNC:14311
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  4. Nagase T, Ishikawa K, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1998 Feb 28;5(1):31-9. [PubMed:9628581 ]
  5. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  6. Lizcano JM, Goransson O, Toth R, Deak M, Morrice NA, Boudeau J, Hawley SA, Udd L, Makela TP, Hardie DG, Alessi DR: LKB1 is a master kinase that activates 13 kinases of the AMPK subfamily, including MARK/PAR-1. EMBO J. 2004 Feb 25;23(4):833-43. Epub 2004 Feb 19. [PubMed:14976552 ]
  7. Suzuki A, Kusakai G, Kishimoto A, Lu J, Ogura T, Lavin MF, Esumi H: Identification of a novel protein kinase mediating Akt survival signaling to the ATM protein. J Biol Chem. 2003 Jan 3;278(1):48-53. Epub 2002 Oct 29. [PubMed:12409306 ]
  8. Al-Hakim AK, Zagorska A, Chapman L, Deak M, Peggie M, Alessi DR: Control of AMPK-related kinases by USP9X and atypical Lys(29)/Lys(33)-linked polyubiquitin chains. Biochem J. 2008 Apr 15;411(2):249-60. doi: 10.1042/BJ20080067. [PubMed:18254724 ]
  9. Suzuki A, Kusakai G, Kishimoto A, Shimojo Y, Miyamoto S, Ogura T, Ochiai A, Esumi H: Regulation of caspase-6 and FLIP by the AMPK family member ARK5. Oncogene. 2004 Sep 16;23(42):7067-75. [PubMed:15273717 ]
  10. Strausberg RL, Feingold EA, Grouse LH, Derge JG, Klausner RD, Collins FS, Wagner L, Shenmen CM, Schuler GD, Altschul SF, Zeeberg B, Buetow KH, Schaefer CF, Bhat NK, Hopkins RF, Jordan H, Moore T, Max SI, Wang J, Hsieh F, Diatchenko L, Marusina K, Farmer AA, Rubin GM, Hong L, Stapleton M, Soares MB, Bonaldo MF, Casavant TL, Scheetz TE, Brownstein MJ, Usdin TB, Toshiyuki S, Carninci P, Prange C, Raha SS, Loquellano NA, Peters GJ, Abramson RD, Mullahy SJ, Bosak SA, McEwan PJ, McKernan KJ, Malek JA, Gunaratne PH, Richards S, Worley KC, Hale S, Garcia AM, Gay LJ, Hulyk SW, Villalon DK, Muzny DM, Sodergren EJ, Lu X, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madan A, Young AC, Shevchenko Y, Bouffard GG, Blakesley RW, Touchman JW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Krzywinski MI, Skalska U, Smailus DE, Schnerch A, Schein JE, Jones SJ, Marra MA: Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11. [PubMed:12477932 ]