You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01270
Secondary Accession Numbers
  • 6566
Name Serine/threonine-protein kinase VRK1
Synonyms
  1. Vaccinia-related kinase 1
Gene Name VRK1
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase activity
Specific Function Serine/threonine kinase that phosphorylates 'Thr-18' of p53/TP53 and may thereby prevent the interaction between p53/TP53 and MDM2
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:1
Locus 14q32
SNPs VRK1
Gene Sequence
>1191 bp
ATGCCTCGTGTAAAAGCAGCTCAAGCTGGAAGACAGAGCTCTGCAAAGAGACATCTTGCA
GAACAATTTGCAGTTGGAGAGATAATAACTGACATGGCAAAAAAGGAATGGAAAGTAGGA
TTACCCATTGGCCAAGGAGGCTTTGGCTGTATATATCTTGCTGATATGAATTCTTCAGAG
TCAGTTGGCAGTGATGCACCTTGTGTTGTAAAAGTGGAACCCAGTGACAATGGACCTCTT
TTTACTGAATTAAAGTTCTACCAACGAGCTGCAAAACCAGAGCAAATTCAGAAATGGATT
CGTACCCGTAAGCTGAAGTACCTGGGTGTTCCTAAGTATTGGGGGTCTGGTCTACATGAC
AAAAATGGAAAAAGTTACAGGTTTATGATAATGGATCGCTTTGGGAGTGACCTTCAGAAA
ATATATGAAGCAAATGCCAAAAGGTTTTCTCGGAAAACTGTCTTGCAGCTAAGCTTAAGA
ATTCTGGATATTCTGGAATATATTCACGAGCATGAGTATGTGCATGGAGATATCAAGGCC
TCAAATCTTCTTCTGAACTACAAGAATCCTGACCAGGTGTACTTGGTAGATTATGGCCTT
GCTTATCGGTACTGCCCAGAAGGAGTTCATAAAGAATACAAAGAAGACCCCAAAAGATGT
CACGATGGCACTATTGAATTCACGAGCATCGATGCACACAATGGTGTGGCCCCATCAAGA
CGTGGTGATTTGGAAATACTTGGTTATTGCATGATCCAATGGCTTACTGGCCATCTTCCT
TGGGAGGATAATTTGAAAGATCCTAAATATGTTAGAGATTCCAAAATTAGATACAGAGAA
AATATTGCAAGTTTGATGGACAAATGTTTTCCTGAGAAAAACAAACCAGGTGAAATTGCC
AAATACATGGAAACAGTGAAATTACTAGACTACACTGAAAAACCTCTTTATGAAAATTTA
CGTGACATTCTTTTGCAAGGACTAAAAGCTATAGGAAGTAAGGATGATGGCAAATTGGAC
CTCAGTGTTGTGGAGAATGGAGGTTTGAAAGCAAAAACAATAACAAAGAAGCGAAAGAAA
GAAATTGAAGAAAGCAAGGAACCTGGTGTTGAAGATACGGAATGGTCAAACACACAGACA
GAGGAGGCCATACAGACCCGTTCAAGAACCAGAAAGAGAGTCCAGAAGTAA
Protein Properties
Number of Residues 396
Molecular Weight 45475.7
Theoretical pI 9.29
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Serine/threonine-protein kinase VRK1
MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSE
SVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHD
KNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKA
SNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSR
RGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIA
KYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKK
EIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK
GenBank ID Protein 1827450
UniProtKB/Swiss-Prot ID Q99986
UniProtKB/Swiss-Prot Entry Name VRK1_HUMAN
PDB IDs Not Available
GenBank Gene ID AB000449
GeneCard ID VRK1
GenAtlas ID VRK1
HGNC ID HGNC:12718
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Nezu J, Oku A, Jones MH, Shimane M: Identification of two novel human putative serine/threonine kinases, VRK1 and VRK2, with structural similarity to vaccinia virus B1R kinase. Genomics. 1997 Oct 15;45(2):327-31. [PubMed:9344656 ]
  3. Lopez-Borges S, Lazo PA: The human vaccinia-related kinase 1 (VRK1) phosphorylates threonine-18 within the mdm-2 binding site of the p53 tumour suppressor protein. Oncogene. 2000 Jul 27;19(32):3656-64. [PubMed:10951572 ]
  4. Barcia R, Lopez-Borges S, Vega FM, Lazo PA: Kinetic properties of p53 phosphorylation by the human vaccinia-related kinase 1. Arch Biochem Biophys. 2002 Mar 1;399(1):1-5. [PubMed:11883897 ]
  5. Renbaum P, Kellerman E, Jaron R, Geiger D, Segel R, Lee M, King MC, Levy-Lahad E: Spinal muscular atrophy with pontocerebellar hypoplasia is caused by a mutation in the VRK1 gene. Am J Hum Genet. 2009 Aug;85(2):281-9. doi: 10.1016/j.ajhg.2009.07.006. Epub 2009 Jul 30. [PubMed:19646678 ]