You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01276
Secondary Accession Numbers
  • 6572
Name 1-phosphatidylinositol-3-phosphate 5-kinase
Synonyms
  1. FYVE finger-containing phosphoinositide kinase
  2. PIKfyve
  3. PIPkin-III
  4. Phosphatidylinositol-3-phosphate 5-kinase
  5. Phosphatidylinositol-3-phosphate 5-kinase type III
  6. Type III PIP kinase
Gene Name PIKFYVE
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol-3,5-bisphosphate (PtdIns(3,5)P2). Catalyzes the phosphorylation of phosphatidylinositol-3-phosphate on the fifth hydroxyl of the myo- inositol ring, to form phosphatidylinositol-3,5-bisphosphate. Required for endocytic-vacuolar pathway and nuclear migration. Plays a role in the biogenesis of endosome carrier vesicles (ECV)/ multivesicular bodies (MVB) transport intermediates from early endosomes
Pathways
  • Inositol Metabolism
  • Joubert syndrome
  • Phosphatidylinositol Phosphate Metabolism
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
zinc ion binding
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
phosphatidylinositol phosphate kinase activity
protein binding
lipid kinase activity
Process
metabolic process
macromolecule metabolic process
phosphatidylinositol metabolic process
cellular protein metabolic process
intracellular signaling pathway
signaling
signaling pathway
protein metabolic process
organophosphate metabolic process
phospholipid metabolic process
glycerophospholipid metabolic process
phosphoinositide metabolic process
Cellular Location
  1. Endosome membrane
Gene Properties
Chromosome Location Chromosome:2
Locus 2q34
SNPs PIKFYVE
Gene Sequence
>6297 bp
ATGGCCACAGATGATAAGACGTCCCCAACACTGGACTCTGCTAATGATTTGCCTCGATCT
CCTACTAGTCCTTCTCATCTCACACACTTTAAACCTTTGACTCCTGATCAAGATGAGCCC
CCTTTTAAATCAGCTTATAGTTCTTTTGTAAATCTCTTTCGTTTTAACAAAGAGAGAGCA
GAAGGAGGCCAGGGAGAACAGCAGCCTTTGAGTGGAAGTTGGACCAGCCCTCAGCTCCCT
TCGAGGACACAGTCTGTTAGGTCACCCACACCTTATAAAAAGCAGCTTAATGAGGAACTC
CAGCGGCGCTCTTCAGCATTAGACACAAGAAGGAAAGCAGAACCTACCTTTGGAGGTCAT
GACCCTCGTACAGCTGTTCAGCTTCGAAGCCTCAGCACAGTATTAAAACGCCTCAAGGAA
ATCATGGAGGGGAAAAGCCAGGATAGTGACCTGAAACAATACTGGATGCCAGATAGCCAA
TGTAAAGAGTGCTATGACTGTAGTGAGAAATTTACAACCTTTAGGCGCAGACACCATTGC
CGACTATGTGGGCAGATTTTCTGCAGTCGTTGCTGTAATCAAGAAATCCCTGGAAAATTT
ATGGGCTATACAGGAGACCTCCGAGCTTGCACATATTGTAGAAAAATAGCCTTAAGTTAT
GCTCATTCCACAGACAGTAATTCTATTGGGGAAGACTTGAATGCTCTTTCAGATTCTGCT
TGCTCTGTGTCTGTGCTTGATCCAAGTGAACCCCGAACACCTGTTGGGAGTAGGAAAGCC
AGCCGTAACATATTTTTAGAGGATGATTTGGCCTGGCAAAGTTTGATTCATCCAGATTCC
TCAAATACTCCTCTTTCAACAAGACTTGTATCTGTGCAAGAGGATGCTGGGAAATCTCCT
GCTCGAAATAGATCAGCCAGCATTACTAACCTGTCACTGGATAGATCTGGTTCTCCTATG
GTACCTTCATATGAGACATCTGTCAGTCCCCAGGCTAACCGAACATATGTTAGGACAGAG
ACCACTGAGGATGAACGCAAAATTCTTCTGGACAGTGTGCAGTTAAAAGACCTGTGGAAA
AAAATCTGCCATCACAGCAGTGGAATGGAGTTTCAGGATCACCGCTACTGGTTGAGAACG
CATCCCAACTGCATTGTAGGAAAGGAATTAGTCAACTGGCTAATCCGAAATGGGCATATT
GCCACAAGGGCACAAGCTATAGCAATTGGACAAGCAATGGTTGATGGACGTTGGCTGGAT
TGTGTTAGTCATCACGACCAGCTTTTCAGAGATGAGTATGCGCTGTATAGACCACTGCAG
AGTACAGAATTTTCTGAGACGCCTTCTCCCGACAGTGACTCAGTGAACTCCGTGGAAGGA
CACTCTGAGCCATCCTGGTTTAAAGACATAAAGTTTGATGACAGTGACACAGAACAGATA
GCTGAAGAAGGTGACGATAATTTGGCTAATTCTGCCAGTCCTAGCAAGCGCACATCAGTC
AGCAGTTTCCAGTCCACAGTGGACAGTGACTCAGCCGCTTCTATCAGCCTGAACGTGGAG
CTGGACAACGTGAACTTCCATATCAAGAAGCCCTCCAAGTACCCACATGTGCCCCCTCAC
CCTGCTGACCAAAAAGAGTATTTGATTTCTGACACTGGAGGACAACAGCTCTCAATAAGT
GACGCTTTCATCAAAGAATCCTTATTTAATCGCCGAGTAGAGGAAAAATCCAAAGAGCTG
CCTTTCACACCTTTGGGCTGGCATCATAACAACCTGGAGCTCCTGAGGGAGGAGAATGGG
GAGAAACAAGCCATGGAGAGGTTGCTTTCAGCTAATCATAACCACATGATGGCACTACTC
CAGCAGTTGCTCCATAGTGACTCACTGTCATCATCTTGGAGGGACATCATCGTGTCATTG
GTCTGCCAGGTTGTTCAGACAGTCCGACCTGATGTCAAGAACCAGGATGATGACATGGAT
ATCCGTCAGTTTGTCCACATCAAAAAAATCCCAGGTGGAAAGAAGTTTGATTCTGTGGTT
GTCAATGGCTTTGTTTGTACCAAGAACATTGCACATAAAAAGATGAGTTCTTGTATTAAA
AACCCCAAAATTCTTCTGTTGAAGTGTTCCATTGAGTATCTCTACAGAGAAGAAACTAAG
TTTACTTGCATTGATCCTATTGTGCTTCAGGAAAGGGAATTCTTGAAGAATTATGTCCAG
CGAATAGTTGATGTTCGACCCACCTTGGTTCTTGTTGAGAAAACAGTGTCTCGGATTGCC
CAGGACATGTTATTGGAACATGGCATTACTTTGGTCATTAATGTAAAGTCACAAGTTTTG
GAACGAATCAGTCGAATGACCCAAGGTGATTTAGTGATGTCAATGGACCAGCTGCTTACG
AAACCACACCTGGGCACTTGTCACAAATTTTATATGCAGATATTTCAGTTGCCTAATGAA
CAAACCAAGACACTGATGTTTTTTGAAGGTTGTCCACAGCACCTAGGCTGTACAATCAAG
CTAAGAGGAGGCTCTGATTATGAGCTGGCTCGAGTTAAGGAGATCCTAATATTTATGATC
TGTGTTGCTTATCATTCTCAACTAGAAATATCCTTTCTCATGGATGAATTTGCTATGCCT
CCCACATTAATGCAAAACCCTTCATTCCATTCCCTGATTGAGGGACGAGGGCATGAGGGG
GCTGTCCAAGAGCAGTACGGTGGAGGTTCCATCCCCTGGGATCCTGACATCCCTCCTGAG
TCTCTGCCCTGTGATGATAGCAGTTTGCTGGAATTGAGGATTGTGTTTGAGAAGGGTGAG
CAGGAAAATAAAAATCTTCCGCAGGCTGTTGCCTCTGTGAAGCATCAAGAACATAGCACA
ACAGCTTGCCCGGCGGGTCTCCCTTGTGCTTTCTTTGCACCTGTACCGGAATCATTGTTG
CCACTCCCTGTGGATGACCAACAAGATGCTTTAGGCAGCGAGCAGCCAGAGACTTTGCAG
CAAACAGTTGTGCTGCAGGATCCCAAAAGCCAGATAAGAGCCTTTAGAGACCCTCTACAG
GATGACACTGGATTATATGTTACTGAGGAAGTCACCTCCTCTGAAGATAAACGAAAGACT
TATTCTTTGGCCTTTAAGCAGGAATTAAAAGATGTGATCCTCTGTATCTCCCCAGTAATC
ACATTCCGAGAACCCTTTCTTTTAACTGAAAAGGGGATGAGATGCTCTACCCGAGATTAT
TTTGCAGAGCAGGTTTACTGGTCTCCTCTCCTCAATAAAGAATTCAAAGAAATGGAGAAC
AGGAGGAAGAAACAGCTGCTCAGGGATCTCTCTGGACTTCAGGGCATGAATGGAAGTATT
CAGGCCAAGTCTATTCAAGTCTTACCCTCACATGAGCTAGTGAGCACTAGAATTGCTGAG
CATCTGGGCGATAGCCAGAGCTTGGGTAGAATGCTGGCCGATTATCGAGCCAGAGGAGGA
AGAATTCAGCCCAAAAATTCAGACCCTTTTGCTCATTCAAAGGATGCATCAAGTACTTCA
AGTGGCCAATCAGGAAGCAAAAATGAGGGTGATGAAGAGAGAGGGCTTATTCTGAGTGAT
GCTGTGTGGTCAACAAAGGTGGACTGTCTGAATCCCATTAATCACCAGAGACTTTGTGTG
CTCTTCAGCAGCTCTTCTGCCCAGTCCAGCAATGCTCCTAGTGCCTGTGTCAGTCCTTGG
ATTGTAACAATGGAATTTTATGGAAAGAATGATCTTACATTAGGAATATTTTTAGAGAGA
TACTGTTTCAGGCCTTCTTATCAGTGTCCAAGCATGTTCTGTGATACCCCCATGGTACAT
CATATTCGGCGCTTTGTTCATGGCCAAGGCTGTGTGCAGATAATCCTGAAGGAGTTGGAT
TCTCCAGTACCTGGATATCAGCATACAATTCTTACATATTCCTGGTGTAGAATCTGCAAA
CAGGTAACACCAGTTGTTGCTCTTTCCAATGAGTCCTGGTCTATGTCATTTGCAAAATAC
CTTGAACTTAGGTTTTATGGGCACCAGTATACTCGCAGAGCCAACGCTGAGCCCTGTGGT
CACTCCATCCATCATGATTATCACCAGTATTTCTCCTATAACCAGATGGTGGCGTCTTTC
AGTTATTCTCCCATTCGGCTTCTTGAAGTATGTGTTCCACTCCCCAAAATATTCATTAAG
CGTCAGGCCCCATTAAAAGTGTCCCTTCTTCAGGATCTGAAGGACTTCTTTCAAAAAGTT
TCACAGGTATATGTTGCCATTGATGAAAGACTTGCATCTTTGAAAACTGATACATTTAGT
AAAACAAGAGAGGAAAAAATGGAAGATATTTTTGCACAGAAAGAGATGGAAGAAGGTGAG
TTCAAGAACTGGATTGAGAAGATGCAAGCAAGGCTCATGTCTTCCTCTGTAGATACCCCT
CAGCAACTGCAGTCGGTCTTTGAGTCACTCATTGCCAAGAAACAAAGTCTCTGTGAAGTG
CTGCAAGCTTGGAATAACAGGTTGCAGGACCTTTTCCAACAGGAAAAGGGTAGAAAGAGA
CCTTCAGTTCCTCCAAGTCCTGGAAGACTGAGACAAGGGGAAGAAAGCAAGATAAGTGCG
ATGGATGCATCTCCACGGAATATTTCTCCAGGACTTCAGAATGGAGAAAAAGAGGATCGC
TTCTTAACAACTTTGTCCAGCCAGAGCTCCACCAGTTCTACTCATCTCCAATTGCCTACG
CCACCTGAAGTCATGTCTGAACAGTCAGTGGGAGGGCCCCCTGAGCTAGATACAGCCAGC
AGTTCCGAAGATGTGTTTGATGGGCATTTGCTGGGATCCACAGACAGCCAAGTGAAGGAA
AAGTCAACCATGAAAGCCATCTTTGCAAATTTGCTTCCAGGAAATAGCTATAATCCTATT
CCATTTCCTTTTGATCCAGATAAACACTACTTAATGTATGAACATGAACGAGTGCCCATT
GCAGTCTGCGAGAAGGAACCCAGCTCCATCATTGCTTTTGCTCTCAGTTGTAAAGAATAC
CGAAATGCCTTAGAGGAATTGTCTAAAGCGACTCAGTGGAACAGTGCCGAAGAAGGGCTT
CCAACAAATAGTACTTCAGATAGCAGACCAAAGAGTAGCAGCCCTATCAGATTACCTGAA
ATGAGTGGAGGACAGACAAATCGTACAACAGAAACAGAACCACAACCAACCAAAAAGGCT
TCTGGAATGTTGTCCTTCTTCAGAGGGACAGCAGGGAAAAGCCCCGATCTCTCTTCCCAG
AAGAGAGAGACCTTACGTGGAGCAGATAGTGCTTACTACCAGGTTGGGCAGACGGGCAAG
GAGGGGACCGAGAATCAAGGCGTTGAGCCTCAAGATGAAGTAGATGGAGGAGATACACAA
AAGAAGCAACTCATAAATCCTCATGTGGAACTTCAATTTTCAGATGCTAATGCCAAGTTT
TACTGTCGGCTCTACTATGCGGGAGAGTTTCATAAGATGCGTGAAGTGATTCTGGACAGC
AGTGAAGAAGATTTCATTCGTTCCCTCTCCCACTCATCACCCTGGCAGGCCCGGGGAGGC
AAATCAGGAGCTGCCTTCTATGCAACTGAGGATGATAGATTTATTTTGAAGCAAATGCCT
CGTCTGGAAGTCCAGTCCTTCCTCGACTTTGCACCACATTACTTCAATTATATTACAAAT
GCTGTTCAACAAAAGAGGCCCACGGCGTTGGCCAAAATTCTTGGAGTTTACAGAATTGGT
TATAAGAACTCTCAGAACAACACTGAGAAGAAGTTAGATCTCCTTGTCATGGAAAATCTT
TTCTACGGGAGAAAGATGGCACAGGTTTTTGATTTGAAGGGCTCTCTTAGGAATCGGAAT
GTAAAAACTGACACTGGAAAAGAGAGTTGTGATGTGGTCCTGCTAGATGAAAATCTCCTA
AAGATGGTTCGAGACAACCCTCTATATATTCGTTCTCATTCCAAAGCTGTGCTGAGAACC
TCGATCCATAGTGACTCCCATTTCCTTTCTAGCCACCTCATTATAGATTATTCTTTGCTG
GTTGGGCGAGATGATACTAGCAATGAGCTAGTAGTTGGAATTATAGATTATATTCGAACA
TTTACATGGGACAAAAAGCTTGAGATGGTTGTGAAATCAACAGGAATTTTAGGTGGACAA
GGTAAAATGCCAACAGTGGTGTCTCCGGAGTTGTACAGGACTAGGTTTTGTGAGGCAATG
GACAAGTATTTCCTAATGGTACCAGACCACTGGACAGGCTTGGGTCTGAATTGCTGA
Protein Properties
Number of Residues 2098
Molecular Weight 237134.1
Theoretical pI 6.67
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>1-phosphatidylinositol-3-phosphate 5-kinase
MATDDKTSPTLDSANDLPRSPTSPSHLTHFKPLTPDQDEPPFKSAYSSFVNLFRFNKERA
EGGQGEQQPLSGSWTSPQLPSRTQSVRSPTPYKKQLNEELQRRSSALDTRRKAEPTFGGH
DPRTAVQLRSLSTVLKRLKEIMEGKSQDSDLKQYWMPDSQCKECYDCSEKFTTFRRRHHC
RLCGQIFCSRCCNQEIPGKFMGYTGDLRACTYCRKIALSYAHSTDSNSIGEDLNALSDSA
CSVSVLDPSEPRTPVGSRKASRNIFLEDDLAWQSLIHPDSSNTPLSTRLVSVQEDAGKSP
ARNRSASITNLSLDRSGSPMVPSYETSVSPQANRTYVRTETTEDERKILLDSVQLKDLWK
KICHHSSGMEFQDHRYWLRTHPNCIVGKELVNWLIRNGHIATRAQAIAIGQAMVDGRWLD
CVSHHDQLFRDEYALYRPLQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQI
AEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPH
PADQKEYLISDTGGQQLSISDAFIKESLFNRRVEEKSKELPFTPLGWHHNNLELLREENG
EKQAMERLLSANHNHMMALLQQLLHSDSLSSSWRDIIVSLVCQVVQTVRPDVKNQDDDMD
IRQFVHIKKIPGGKKFDSVVVNGFVCTKNIAHKKMSSCIKNPKILLLKCSIEYLYREETK
FTCIDPIVLQEREFLKNYVQRIVDVRPTLVLVEKTVSRIAQDMLLEHGITLVINVKSQVL
ERISRMTQGDLVMSMDQLLTKPHLGTCHKFYMQIFQLPNEQTKTLMFFEGCPQHLGCTIK
LRGGSDYELARVKEILIFMICVAYHSQLEISFLMDEFAMPPTLMQNPSFHSLIEGRGHEG
AVQEQYGGGSIPWDPDIPPESLPCDDSSLLELRIVFEKGEQENKNLPQAVASVKHQEHST
TACPAGLPCAFFAPVPESLLPLPVDDQQDALGSEQPETLQQTVVLQDPKSQIRAFRDPLQ
DDTGLYVTEEVTSSEDKRKTYSLAFKQELKDVILCISPVITFREPFLLTEKGMRCSTRDY
FAEQVYWSPLLNKEFKEMENRRKKQLLRDLSGLQGMNGSIQAKSIQVLPSHELVSTRIAE
HLGDSQSLGRMLADYRARGGRIQPKNSDPFAHSKDASSTSSGQSGSKNEGDEERGLILSD
AVWSTKVDCLNPINHQRLCVLFSSSSAQSSNAPSACVSPWIVTMEFYGKNDLTLGIFLER
YCFRPSYQCPSMFCDTPMVHHIRRFVHGQGCVQIILKELDSPVPGYQHTILTYSWCRICK
QVTPVVALSNESWSMSFAKYLELRFYGHQYTRRANAEPCGHSIHHDYHQYFSYNQMVASF
SYSPIRLLEVCVPLPKIFIKRQAPLKVSLLQDLKDFFQKVSQVYVAIDERLASLKTDTFS
KTREEKMEDIFAQKEMEEGEFKNWIEKMQARLMSSSVDTPQQLQSVFESLIAKKQSLCEV
LQAWNNRLQDLFQQEKGRKRPSVPPSPGRLRQGEESKISAMDASPRNISPGLQNGEKEDR
FLTTLSSQSSTSSTHLQLPTPPEVMSEQSVGGPPELDTASSSEDVFDGHLLGSTDSQVKE
KSTMKAIFANLLPGNSYNPIPFPFDPDKHYLMYEHERVPIAVCEKEPSSIIAFALSCKEY
RNALEELSKATQWNSAEEGLPTNSTSDSRPKSSSPIRLPEMSGGQTNRTTETEPQPTKKA
SGMLSFFRGTAGKSPDLSSQKRETLRGADSAYYQVGQTGKEGTENQGVEPQDEVDGGDTQ
KKQLINPHVELQFSDANAKFYCRLYYAGEFHKMREVILDSSEEDFIRSLSHSSPWQARGG
KSGAAFYATEDDRFILKQMPRLEVQSFLDFAPHYFNYITNAVQQKRPTALAKILGVYRIG
YKNSQNNTEKKLDLLVMENLFYGRKMAQVFDLKGSLRNRNVKTDTGKESCDVVLLDENLL
KMVRDNPLYIRSHSKAVLRTSIHSDSHFLSSHLIIDYSLLVGRDDTSNELVVGIIDYIRT
FTWDKKLEMVVKSTGILGGQGKMPTVVSPELYRTRFCEAMDKYFLMVPDHWTGLGLNC
GenBank ID Protein 121583483
UniProtKB/Swiss-Prot ID Q9Y2I7
UniProtKB/Swiss-Prot Entry Name FYV1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_015040.3
GeneCard ID PIKFYVE
GenAtlas ID PIKFYVE
HGNC ID HGNC:23785
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  3. Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ: Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Nat Biotechnol. 2005 Jan;23(1):94-101. Epub 2004 Dec 12. [PubMed:15592455 ]
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  5. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  6. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  7. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  8. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  9. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  10. Brill LM, Salomon AR, Ficarro SB, Mukherji M, Stettler-Gill M, Peters EC: Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry. Anal Chem. 2004 May 15;76(10):2763-72. [PubMed:15144186 ]
  11. Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Feb 26;6(1):63-70. [PubMed:10231032 ]
  12. Sbrissa D, Ikonomov OC, Shisheva A: Phosphatidylinositol 3-phosphate-interacting domains in PIKfyve. Binding specificity and role in PIKfyve. Endomenbrane localization. J Biol Chem. 2002 Feb 22;277(8):6073-9. Epub 2001 Nov 12. [PubMed:11706043 ]
  13. Sbrissa D, Ikonomov OC, Fu Z, Ijuin T, Gruenberg J, Takenawa T, Shisheva A: Core protein machinery for mammalian phosphatidylinositol 3,5-bisphosphate synthesis and turnover that regulates the progression of endosomal transport. Novel Sac phosphatase joins the ArPIKfyve-PIKfyve complex. J Biol Chem. 2007 Aug 17;282(33):23878-91. Epub 2007 Jun 7. [PubMed:17556371 ]
  14. Sbrissa D, Ikonomov OC, Fenner H, Shisheva A: ArPIKfyve homomeric and heteromeric interactions scaffold PIKfyve and Sac3 in a complex to promote PIKfyve activity and functionality. J Mol Biol. 2008 Dec 26;384(4):766-79. doi: 10.1016/j.jmb.2008.10.009. Epub 2008 Oct 11. [PubMed:18950639 ]
  15. Li S, Tiab L, Jiao X, Munier FL, Zografos L, Frueh BE, Sergeev Y, Smith J, Rubin B, Meallet MA, Forster RK, Hejtmancik JF, Schorderet DF: Mutations in PIP5K3 are associated with Francois-Neetens mouchetee fleck corneal dystrophy. Am J Hum Genet. 2005 Jul;77(1):54-63. Epub 2005 May 18. [PubMed:15902656 ]