Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01298
Secondary Accession Numbers
  • 6594
Name Collagen type IV alpha-3-binding protein
Synonyms
  1. Ceramide transfer protein
  2. GPBP
  3. Goodpasture antigen-binding protein
  4. START domain-containing protein 11
  5. StAR-related lipid transfer protein 11
  6. StARD11
  7. hCERT
Gene Name COL4A3BP
Protein Type Enzyme
Biological Properties
General Function Involved in protein binding
Specific Function May mediate the intracellular trafficking of ceramide in a non-vesicular manner
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cytoplasm
  2. Golgi apparatus
  3. Endoplasmic reticulum
Gene Properties
Chromosome Location Chromosome:5
Locus 5q13.3
SNPs COL4A3BP
Gene Sequence
>1875 bp
ATGTCGGATAATCAGAGCTGGAACTCGTCGGGCTCGGAGGAGGATCCAGAGACGGAGTCT
GGGCCGCCTGTGGAGCGCTGCGGGGTCCTCAGTAAGTGGACAAACTACATTCATGGGTGG
CAGGATCGTTGGGTAGTTTTGAAAAATAATGCTCTGAGTTACTACAAATCTGAAGATGAA
ACAGAGTATGGCTGCAGAGGATCCATCTGTCTTAGCAAGGCTGTCATCACACCTCACGAT
TTTGATGAATGTCGATTTGATATTAGTGTAAATGATAGTGTTTGGTATCTTCGTGCTCAG
GATCCAGATCATAGACAGCAATGGATAGATGCCATTGAACAGCACAAGACTGAATCTGGA
TATGGATCTGAATCCAGCTTGCGTCGACATGGCTCAATGGTGTCCCTGGTGTCTGGAGCA
AGTGGCTACTCTGCAACATCCACCTCTTCATTCAAGAAAGGCCACAGTTTACGTGAGAAG
TTGGCTGAAATGGAAACATTTAGAGACATCTTATGTAGACAAGTTGACACGCTACAGAAG
TACTTTGATGCCTGTGCTGATGCTGTCTCTAAGGATGAACTTCAAAGGGATAAAGTGGTA
GAAGATGATGAAGATGACTTTCCTACAACGCGTTCTGATGGTGACTTCTTGCATAGTACC
AACGGCAATAAAGAAAAGTTATTTCCACATGTGACACCAAAAGGAATTAATGGTATAGAC
TTTAAAGGGGAAGCGATAACTTTTAAAGCAACTACTGCTGGAATCCTTGCAACACTTTCT
CATTGTATTGAACTAATGGTTAAACGTGAGGACAGCTGGCAGAAGAGACTGGATAAGGAA
ACTGAGAAGAAAAGAAGAACAGAGGAAGCATATAAAAATGCAATGACAGAACTTAAGAAA
AAATCCCACTTTGGAGGACCAGATTATGAAGAAGGCCCTAACAGTCTGATTAATGAAGAA
GAGTTCTTTGATGCTGTTGAAGCTGCTCTTGACAGACAAGATAAAATAGAAGAACAGTCA
CAGAGTGAAAAGGTGAGATTACATTGGCCTACATCCTTGCCCTCTGGAGATGCCTTTTCT
TCTGTGGGGACACATAGATTTGTCCAAAAGCCCTATAGTCGCTCTTCCTCCATGTCTTCC
ATTGATCTAGTCAGTGCCTCTGATGATGTTCACAGATTCAGCTCCCAGGTTGAAGAGATG
GTGCAGAACCACATGACTTACTCATTACAGGATGTAGGCGGAGATGCCAATTGGCAGTTG
GTTGTAGAAGAAGGAGAAATGAAGGTATACAGAAGAGAAGTAGAAGAAAATGGGATTGTT
CTGGATCCTTTAAAAGCTACCCATGCAGTTAAAGGCGTCACAGGACATGAAGTCTGCAAT
TATTTCTGGAATGTTGACGTTCGCAATGACTGGGAAACAACTATAGAAAACTTTCATGTG
GTGGAAACATTAGCTGATAATGCAATCATCATTTATCAAACACACAAGAGGGTGTGGCCT
GCTTCTCAGCGAGACGTATTATATCTTTCTGTCATTCGAAAGATACCAGCCTTGACTGAA
AATGACCCTGAAACTTGGATAGTTTGTAATTTTTCTGTGGATCATGACAGTGCTCCTCTA
AACAACCGATGTGTCCGTGCCAAAATAAATGTTGCTATGATTTGTCAAACCTTGGTAAGC
CCACCAGAGGGAAACCAGGAAATTAGCAGGGACAACATTCTATGCAAGATTACATATGTA
GCTAATGTGAACCCTGGAGGATGGGCACCAGCCTCAGTGTTAAGGGCAGTGGCAAAGCGA
GAGTATCCTAAATTTCTAAAACGTTTTACTTCTTACGTCCAAGAAAAAACTGCAGGAAAG
CCTATTTTGTTCTAG
Protein Properties
Number of Residues 624
Molecular Weight 70834.4
Theoretical pI 5.15
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Collagen type IV alpha-3-binding protein
MSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDE
TEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHKTESG
YGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQK
YFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHSTNGNKEKLFPHVTPKGINGID
FKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKETEKKRRTEEAYKNAMTELKK
KSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHWPTSLPSGDAFS
SVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYSLQDVGGDANWQL
VVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHV
VETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFSVDHDSAPL
NNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKR
EYPKFLKRFTSYVQEKTAGKPILF
GenBank ID Protein 5031717
UniProtKB/Swiss-Prot ID Q9Y5P4
UniProtKB/Swiss-Prot Entry Name C43BP_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_005713.2
GeneCard ID COL4A3BP
GenAtlas ID COL4A3BP
HGNC ID HGNC:2205
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  6. Raya A, Revert F, Navarro S, Saus J: Characterization of a novel type of serine/threonine kinase that specifically phosphorylates the human goodpasture antigen. J Biol Chem. 1999 Apr 30;274(18):12642-9. [PubMed:10212244 ]
  7. Raya A, Revert-Ros F, Martinez-Martinez P, Navarro S, Rosello E, Vieites B, Granero F, Forteza J, Saus J: Goodpasture antigen-binding protein, the kinase that phosphorylates the goodpasture antigen, is an alternatively spliced variant implicated in autoimmune pathogenesis. J Biol Chem. 2000 Dec 22;275(51):40392-9. [PubMed:11007769 ]
  8. Hanada K, Kumagai K, Yasuda S, Miura Y, Kawano M, Fukasawa M, Nishijima M: Molecular machinery for non-vesicular trafficking of ceramide. Nature. 2003 Dec 18;426(6968):803-9. [PubMed:14685229 ]
  9. Kawano M, Kumagai K, Nishijima M, Hanada K: Efficient trafficking of ceramide from the endoplasmic reticulum to the Golgi apparatus requires a VAMP-associated protein-interacting FFAT motif of CERT. J Biol Chem. 2006 Oct 6;281(40):30279-88. Epub 2006 Aug 8. [PubMed:16895911 ]
  10. Fugmann T, Hausser A, Schoffler P, Schmid S, Pfizenmaier K, Olayioye MA: Regulation of secretory transport by protein kinase D-mediated phosphorylation of the ceramide transfer protein. J Cell Biol. 2007 Jul 2;178(1):15-22. Epub 2007 Jun 25. [PubMed:17591919 ]