You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01316
Secondary Accession Numbers
  • 6612
Name Calcium/calmodulin-dependent protein kinase kinase 1
Synonyms
  1. CaM-KK 1
  2. CaM-KK alpha
  3. CaM-kinase IV kinase
  4. CaM-kinase kinase 1
  5. CaM-kinase kinase alpha
  6. CaMKK 1
  7. CaMKK alpha
  8. Calcium/calmodulin-dependent protein kinase kinase alpha
Gene Name CAMKK1
Protein Type Unknown
Biological Properties
General Function Involved in protein kinase activity
Specific Function Calcium/calmodulin-dependent protein kinase that belongs to a proposed calcium-triggered signaling cascade involved in a number of cellular processes. Phosphorylates CAMK1, CAMK1D, CAMK1G and CAMK4. Involved in regulating cell apoptosis. Promotes cell survival by phosphorylating AKT1/PKB that inhibits pro-apoptotic BAD/Bcl2-antagonist of cell death
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 17p13.2
SNPs CAMKK1
Gene Sequence
>1518 bp
ATGGAGGGGGGTCCAGCTGTCTGCTGCCAGGATCCTCGGGCAGAGCTGGTAGAACGGGTG
GCAGCCATCGATGTGACTCACTTGGAGGAGGCAGATGGTGGCCCAGAGCCTACTAGAAAC
GGTGTGGACCCCCCACCACGGGCCAGAGCTGCCTCTGTGATCCCTGGCAGTACTTCAAGA
CTGCTCCCAGCCCGGCCTAGCCTCTCAGCCAGGAAGCTTTCCCTACAGGAGCGGCCAGCA
GGAAGCTATCTGGAGGCGCAGGCTGGGCCTTATGCCACGGGGCCTGCCAGCCACATCTCC
CCCCGGGCCTGGCGGAGGCCCACCATCGAGTCCCACCACGTGGCCATCTCAGATGCAGAG
GACTGCGTGCAGCTGAACCAGTACAAGCTGCAGAGTGAGATTGGCAAGGGTGCCTACGGT
GTGGTGAGGCTGGCCTACAACGAAAGTGAAGACAGACACTATGCAATGAAAGTCCTTTCC
AAAAAGAAGTTACTGAAGCAGTATGGCTTTCCACGTCGCCCTCCCCCGAGAGGGTCCCAG
GCTGCCCAGGGAGGACCAGCCAAGCAGCTGCTGCCCCTGGAGCGGGTGTACCAGGAGATT
GCCATCCTGAAGAAGCTGGACCACGTGAATGTGGTCAAACTGATCGAGGTCCTGGATGAC
CCAGCTGAGGACAACCTCTATTTGGTGTTTGACCTCCTGAGAAAGGGGCCCGTCATGGAA
GTGCCCTGTGACAAGCCCTTCTCGGAGGAGCAAGCTCGCCTCTACCTGCGGGACGTCATC
CTGGGCCTCGAGTACTTGCACTGCCAGAAGATCGTCCACAGGGACATCAAGCCATCCAAC
CTGCTCCTGGGGGATGATGGGCACGTGAAGATCGCCGACTTTGGCGTCAGCAACCAGTTT
GAGGGGAACGACGCTCAGCTGTCCAGCACGGCGGGAACCCCAGCATTCATGGCCCCCGAG
GCCATTTCTGATTCCGGCCAGAGCTTCAGTGGGAAGGCCTTGGATGTATGGGCCACTGGC
GTCACGTTGTACTGCTTTGTCTATGGGAAGTGCCCATTCATCGACGATTTCATCCTGGCC
CTCCACAGGAAGATCAAGAATGAGCCCGTGGTGTTTCCTGAGGAGCCAGAAATCAGCGAG
GAGCTCAAGGACCTGATCCTGAAGATGTTAGACAAGAATCCCGAGACGAGAATTGGGGTG
CCAGACATCAAGTTGCACCCTTGGGTGACCAAGAACGGGGAGGAGCCCCTTCCTTCGGAG
GAGGAGCACTGCAGCGTGGTGGAGGTGACAGAGGAGGAGGTTAAGAACTCAGTCAGGCTC
ATCCCCAGCTGGACCACGGTGATCCTGGTGAAGTCCATGCTGAGGAAGCGTTCCTTTGGG
AACCCGTTTGAGCCCCAAGCACGGAGGGAAGAGCGATCCATGTCTGCTCCAGGAAACCTA
CTGGTGAAAGAAGGGTTTGGTGAAGGGGGCAAGAGCCCAGAGCTCCCCGGCGTCCAGGAA
GACGAGGCTGCATCCTGA
Protein Properties
Number of Residues 505
Molecular Weight 55735.0
Theoretical pI 5.55
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Calcium/calmodulin-dependent protein kinase kinase 1
MEGGPAVCCQDPRAELVERVAAIDVTHLEEADGGPEPTRNGVDPPPRARAASVIPGSTSR
LLPARPSLSARKLSLQERPAGSYLEAQAGPYATGPASHISPRAWRRPTIESHHVAISDAE
DCVQLNQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQ
AAQGGPAKQLLPLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVME
VPCDKPFSEEQARLYLRDVILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQF
EGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDFILA
LHRKIKNEPVVFPEEPEISEELKDLILKMLDKNPETRIGVPDIKLHPWVTKNGEEPLPSE
EEHCSVVEVTEEEVKNSVRLIPSWTTVILVKSMLRKRSFGNPFEPQARREERSMSAPGNL
LVKEGFGEGGKSPELPGVQEDEAAS
GenBank ID Protein 23499314
UniProtKB/Swiss-Prot ID Q8N5S9
UniProtKB/Swiss-Prot Entry Name KKCC1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF425232
GeneCard ID CAMKK1
GenAtlas ID CAMKK1
HGNC ID HGNC:1469
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  5. Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A: Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Genome Res. 2001 Mar;11(3):422-35. [PubMed:11230166 ]
  6. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  7. Ishikawa Y, Tokumitsu H, Inuzuka H, Murata-Hori M, Hosoya H, Kobayashi R: Identification and characterization of novel components of a Ca2+/calmodulin-dependent protein kinase cascade in HeLa cells. FEBS Lett. 2003 Aug 28;550(1-3):57-63. [PubMed:12935886 ]