You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01320
Secondary Accession Numbers
  • 6616
Name Dual specificity tyrosine-phosphorylation-regulated kinase 2
Synonyms Not Available
Gene Name DYRK2
Protein Type Unknown
Biological Properties
General Function Involved in protein kinase activity
Specific Function Role in the regulation of cellular growth and/or development. Regulates TP53 by phosphorylation on Ser-46 to induce apoptosis in response to DNA damage, functioning downstream of ATM. Inactivates GYS1 by phosphorylation at Ser-641, and potentially also a second phosphorylation site, thus regulating glycogen synthesis. Phosphorylates EIF2B5 at Ser-544, enabling its subsequent phosphorylation and inhibition by GSK3, and may play a more general role in the priming of GSK3 substrates
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 12q15
SNPs DYRK2
Gene Sequence
>1806 bp
ATGTTAACCAGGAAACCTTCGGCCGCCGCTCCCGCCGCCTACCCGACCGGCCGAGGTGGG
GACAGCGCCGTTCGTCAGCTTCAGGCTTCCCCGGGGCTCGGTGCAGGGGCCACCCGGAGC
GGAGTGGGGACTGGCCCGCCCTCCCCCATCGCCCTGCCGCCTCTCCGGGCCAGCAACGCT
GCCGCCGCAGCCCACACGATTGGCGGCAGTAAGCACACAATGAATGATCACCTGCATGTC
GGCAGCCACGCTCACGGACAGATCCAGGTTCAACAGTTGTTTGAGGATAACAGTAACAAG
CGGACAGTGCTCACGACACAACCAAATGGGCTTACAACAGTGGGCAAAACGGGCTTGCCA
GTGGTGCCAGAGCGGCAGCTGGACAGCATTCATAGACGGCAGGGGAGCTCCACCTCTCTA
AAGTCCATGGAAGGCATGGGGAAGGTGAAAGCCACCCCCATGACACCTGAACAAGCAATG
AAGCAATACATGCAAAAACTCACAGCCTTCGAACACCATGAGATTTTCAGCTACCCTGAA
ATATATTTCTTGGGTCTAAATGCTAAGAAGCGCCAGGGCATGACAGGTGGGCCCAACAAT
GGTGGCTATGATGATGACCAGGGATCATATGTGCAGGTGCCCCACGATCACGTGGCTTAC
AGGTATGAGGTCCTCAAGGTCATTGGGAAGGGGAGCTTTGGGCAGGTGGTCAAGGCCTAC
GATCACAAAGTCCACCAGCACGTGGCCCTAAAGATGGTGCGGAATGAGAAGCGCTTCCAC
CGGCAAGCAGCGGAGGAGATCCGAATCCTGGAACACCTGCGGAAGCAGGACAAGGATAAC
ACAATGAATGTCATCCATATGCTGGAGAATTTCACCTTCCGCAACCACATCTGCATGACG
TTTGAGCTGCTGAGCATGAACCTCTATGAGCTCATCAAGAAGAATAAATTCCAGGGCTTC
AGTCTGCCTTTGGTTCGCAAGTTTGCCCACTCGATTCTGCAGTGCTTGGATGCTTTGCAC
AAAAACAGAATAATTCACTGTGACCTTAAGCCCGAGAACATTTTGTTAAAGCAGCAGGGT
AGAAGCGGTATTAAAGTAATTGATTTTGGCTCCAGTTGTTACGAGCATCAGCGTGTCTAC
ACGTACATCCAGTCGCGTTTTTACCGGGCTCCAGAAGTGATCCTTGGGGCCAGGTATGGC
ATGCCCATTGATATGTGGAGCCTGGGCTGCATTTTAGCAGAGCTCCTGACGGGTTACCCC
CTCTTGCCTGGGGAAGATGAAGGGGACCAGCTGGCCTGTATGATTGAACTGTTGGGCATG
CCCTCACAGAAACTGCTGGATGCATCCAAACGAGCCAAAAATTTTGTGAGCTCCAAGGGT
TATCCCCGTTACTGCACTGTCACGACTCTCTCAGATGGCTCTGTGGTCCTAAACGGAGGC
CGTTCCCGGAGGGGGAAACTGAGGGGCCCACCGGAGAGCAGAGAGTGGGGTAACGCGCTG
AAGGGGTGTGATGATCCCCTTTTCCTTGACTTCTTAAAACAGTGTTTAGAGTGGGATCCT
GCAGTGCGCATGACCCCAGGCCAGGCTTTGCGGCACCCCTGGCTGAGGAGGCGGTTGCCA
AAGCCTCCCACCGGGGAGAAAACGTCAGTGAAAAGGATAACTGAGAGCACCGGTGCTATC
ACATCTATATCCAAGTTACCTCCACCTTCTAGCTCAGCTTCCAAACTGAGGACTAATTTG
GCGCAGATGACAGATGCCAATGGGAATATTCAGCAGAGGACAGTGTTGCCAAAACTTGTT
AGCTGA
Protein Properties
Number of Residues 601
Molecular Weight 66651.2
Theoretical pI 10.2
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Dual specificity tyrosine-phosphorylation-regulated kinase 2
MLTRKPSAAAPAAYPTGRGGDSAVRQLQASPGLGAGATRSGVGTGPPSPIALPPLRASNA
AAAAHTIGGSKHTMNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLP
VVPERQLDSIHRRQGSSTSLKSMEGMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPE
IYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAY
DHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMT
FELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQG
RSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYP
LLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGG
RSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLP
KPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLV
S
GenBank ID Protein 189054136
UniProtKB/Swiss-Prot ID Q92630
UniProtKB/Swiss-Prot Entry Name DYRK2_HUMAN
PDB IDs Not Available
GenBank Gene ID AK313937
GeneCard ID DYRK2
GenAtlas ID DYRK2
HGNC ID HGNC:3093
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  5. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  6. Skurat AV, Dietrich AD: Phosphorylation of Ser640 in muscle glycogen synthase by DYRK family protein kinases. J Biol Chem. 2004 Jan 23;279(4):2490-8. Epub 2003 Oct 30. [PubMed:14593110 ]
  7. Becker W, Weber Y, Wetzel K, Eirmbter K, Tejedor FJ, Joost HG: Sequence characteristics, subcellular localization, and substrate specificity of DYRK-related kinases, a novel family of dual specificity protein kinases. J Biol Chem. 1998 Oct 2;273(40):25893-902. [PubMed:9748265 ]
  8. Woods YL, Cohen P, Becker W, Jakes R, Goedert M, Wang X, Proud CG: The kinase DYRK phosphorylates protein-synthesis initiation factor eIF2Bepsilon at Ser539 and the microtubule-associated protein tau at Thr212: potential role for DYRK as a glycogen synthase kinase 3-priming kinase. Biochem J. 2001 May 1;355(Pt 3):609-15. [PubMed:11311121 ]
  9. Taira N, Nihira K, Yamaguchi T, Miki Y, Yoshida K: DYRK2 is targeted to the nucleus and controls p53 via Ser46 phosphorylation in the apoptotic response to DNA damage. Mol Cell. 2007 Mar 9;25(5):725-38. [PubMed:17349958 ]