You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01330
Secondary Accession Numbers
  • 6626
Name Serine/threonine-protein kinase ULK1
Synonyms
  1. Unc-51-like kinase 1
Gene Name ULK1
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase activity
Specific Function Involved in autophagy. Required for autophagosome formation. Target of the TOR kinase signaling pathway that regulates autophagy through the control of phosphorylation status of ATG13/KIAA0652 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex. Phosphorylates ATG13/KIAA0652. Involved in axon growth. Plays an essential role in neurite extension of cerebellar granule cells
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular process
biological regulation
regulation of biological process
cellular metabolic process
cell projection organization
cell projection morphogenesis
neuron projection morphogenesis
axonogenesis
regulation of cellular process
signal transduction
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Cytoplasm
  2. cytosol
  3. Preautophagosomal structure
Gene Properties
Chromosome Location Chromosome:1
Locus 12q24.3
SNPs ULK1
Gene Sequence
>3153 bp
ATGGAGCCCGGCCGCGGCGGCACAGAGACCGTGGGCAAGTTCGAGTTCTCCCGCAAGGAC
CTGATCGGCCACGGCGCCTTCGCGGTGGTCTTCAAGGGCCGCCACCGCGAGAAGCACGAT
TTGGAGGTCGCCGTCAAGTGCATTAACAAGAAGAACCTCGCCAAGTCTCAGACGCTGCTG
GGGAAGGAAATCAAAATCCTGAAGGAACTGAAACATGAAAACATCGTGGCCCTGTACGAC
TTCCAGGAAATGGCTAATTCTGTCTACCTGGTTATGGAGTACTGCAACGGTGGGGACCTG
GCCGACTACCTGCACGCCATGCGCACGCTGAGCGAGGACACCATCAGGCTCTTCCTGCAG
CAGATCGCGGGCGCCATGCGGCTTCTGCACAGCAAAGGCATCATCCACCGCGACCTGAAA
CCGCAGAACATCCTGCTGTCCAACCCCGCCGGCCGCCGCGCCAACCCCAACAGCATCCGC
GTCAAGATCGCTGACTTCGGCTTCGCGCGGTACCTCCAGAGCAACATGATGGCGGCCACA
CTCTGCGGCTCCCCCATGTACATGGCCCCCGAGGTCATCATGTCCCAGCACTACGACGGG
AAGGCGGACCTGTGGAGCATCGGCACCATCGTCTACCAGTGCCTGACGGGGAAGGCGCCC
TTCCAGGCCAGCAGCCCCCAGGACCTGCGCCTGTTCTACGAGAAGAACAAGACGTTGGTC
CCCACCATCCCCCGGGAGACCTCGGCCCCGCTGCGGCAGCTGCTCCTGGCCCTACTGCAA
CGCAACCACAAGGACCGCATGGACTTCGATGAGTTTTTTCATCACCCTTTCCTCGATGCC
AGCCCCTCGGTCAGGAAATCCCCACCCGTGCCTGTGCCCTCGTACCCAAGCTCGGGGTCC
GGCAGCAGCTCCAGCAGCAGCTCCACCTCCCACCTGGCCTCCCCGCCGTCCCTGGGCGAG
ATGCAGCAGCTGCAGAAGACCCTGGCCTCCCCGGCTGACACCGCTGGCTTCCTGCACAGC
TCCCGGGACTCTGGTGGCAGCAAGGACTCTTCCTGTGACACAGACGACTTCGTCATGGTC
CCCGCGCAGTTTCCAGGTGACCTGGTGGCTGAGGCGCCCAGTGCCAAACCCCCGCCAGAC
AGCCTGATGTGCAGTGGGAGCTCACTGGTGGCCTCTGCGGGCTTGGAGAGCCACGGCCGG
ACCCCATCTCCATCCCCACCCTGCAGCAGCTCCCCCAGTCCCTCAGGCCGGGCTGGCCCG
TTCTCCAGCAGCAGGTGCGGCGCCTCTGTCCCCATCCCAGTCCCCACGCAGGTGCAGAAC
TACCAGCGCATTGAGCGAAACCTGCAGTCACCCACCCAGTTCCAAACACCTCGGTCCTCT
GCCATCCGCAGGTCAGGCAGCACCAGCCCCCTGGGCTTTGCAAGGGCCAGCCCCTCGCCC
CCTGCCCACGCTGAGCATGGAGGCGTCCTGGCCAGGAAGATGTCTCTGGGTGGAGGCCGG
CCCTACACGCCATCTCCTCAAGTTGGAACCATCCCTGAGCGGCCAGGCTGGAGCGGGACG
CCCTCCCCACAGGGAGCTGAGATGCGGGGTGGCAGGTCCCCTCGTCCAGGCTCCTCTGCA
CCCGAGCACTCTCCCCGCACTTCCGGGCTGGGCTGCCGCCTGCACAGCGCCCCCAACCTG
TCTGACTTGCACGTCGTCCGCCCCAAGCTGCCCAAACCCCCCACGGACCCCCTGGGAGCT
GTGTTCAGCCCACCACAGGCCAGCCCTCCCCAGCCGTCCCACGGCCTGCAGTCCTGCCGG
AACCTGCGGGGCTCACCCAAGCTGCCCGACTTCCTGCAGCGAAACCCCCTGCCCCCCATC
CTGGGCTCCCCCACCAAGGCTGTGCCCTCCTTTGACTTCCCGAAGACCCCCAGCTCCCAG
AACCTGCTGGCCCTCCTAGCCCGGCAGGGCGTGGTGATGACGCCCCCTCGAAACCGGACG
CTGCCCGACCTCTCGGAGGTGGGACCCTTCCATGGTCAGCCGTTGGGCCCTGGCCTGCGG
CCAGGCGAGGACCCCAAGGGCCCCTTTGGCCGGTCTTTCAGCACCAGCCGCCTCACTGAC
CTGCTCCTTAAGGCGGCGTTTGGGACACAAGCCCCGGACCCGGGCAGCACGGAGAGCCTG
CAGGAGAAGCCCATGGAGATCGCACCCTCAGCTGGCTTTGGAGGGAGCCTGCACCCAGGA
GCCCGTGCTGGGGGCACCAGCAGCCCTTCCCCGGTGGTCTTCACCGTGGGCTCTCCCCCG
AGCGGGAGCACGCCCCCCCAGGGCCCCCGCACCAGGATGTTCTCAGCGGGCCCCACTGGC
TCTGCCAGCTCTTCTGCCCGCCACCTGGTGCCTGGGCCCTGCAGCGAGGCCCCAGCCCCT
GAGCTCCCTGCTCCAGGACACGGCTGCAGCTTTGCCGACCCCATTGCTGCGAACCTGGAG
GGGGCTGTGACCTTCGAGGCCCCCGACCTCCCTGAGGAGACCCTCATGGAGCAAGAGCAC
ACGGAGATCCTGCGTGGCCTGCGCTTCACGCTGCTGTTCGTGCAGCACGTCCTGGAGATC
GCAGCCCTGAAGGGCAGCGCCAGTGAGGCGGCGGGGGGCCCTGAGTACCAGCTGCAGGAG
AGTGTGGTGGCCGACCAGATCAGCCTGCTGAGCCGAGAATGGGGCTTCGCGGAACAGCTG
GTGCTGTACCTGAAGGTGGCCGAGCTACTGTCCTCCGGCCTGCAAAGTGCCATCGACCAG
ATCCGGGCCGGCAAGCTCTGCCTGTCGTCCACTGTGAAGCAGGTGGTGCGCAGGCTGAAT
GAGCTGTACAAGGCCAGCGTGGTGTCCTGCCAGGGCCTGAGCCTGCGGCTGCAGCGCTTC
TTCCTGGACAAGCAGCGGCTCCTGGACCGCATTCACAGCATCACTGCCGAGAGGCTCATC
TTCAGCCACGCTGTGCAGATGGTGCAGTCGGCTGCCCTGGACGAGATGTTCCAGCACCGT
GAGGGCTGCGTCCCACGCTACCACAAGGCCCTGCTGCTCCTGGAGGGGCTGCAGCACATG
CTCTCGGACCAGGCCGACATCGAGAACGTCACCAAGTGCAAGCTGTGCATTGAGCGGAGA
CTCTCGGCGCTGCTGACTGGCATCTGTGCCTGA
Protein Properties
Number of Residues 1050
Molecular Weight 112600.1
Theoretical pI 8.99
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Serine/threonine-protein kinase ULK1
MEPGRGGTETVGKFEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKKNLAKSQTLL
GKEIKILKELKHENIVALYDFQEMANSVYLVMEYCNGGDLADYLHAMRTLSEDTIRLFLQ
QIAGAMRLLHSKGIIHRDLKPQNILLSNPAGRRANPNSIRVKIADFGFARYLQSNMMAAT
LCGSPMYMAPEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTLV
PTIPRETSAPLRQLLLALLQRNHKDRMDFDEFFHHPFLDASPSVRKSPPVPVPSYPSSGS
GSSSSSSSTSHLASPPSLGEMQQLQKTLASPADTAGFLHSSRDSGGSKDSSCDTDDFVMV
PAQFPGDLVAEAPSAKPPPDSLMCSGSSLVASAGLESHGRTPSPSPPCSSSPSPSGRAGP
FSSSRCGASVPIPVPTQVQNYQRIERNLQSPTQFQTPRSSAIRRSGSTSPLGFARASPSP
PAHAEHGGVLARKMSLGGGRPYTPSPQVGTIPERPGWSGTPSPQGAEMRGGRSPRPGSSA
PEHSPRTSGLGCRLHSAPNLSDLHVVRPKLPKPPTDPLGAVFSPPQASPPQPSHGLQSCR
NLRGSPKLPDFLQRNPLPPILGSPTKAVPSFDFPKTPSSQNLLALLARQGVVMTPPRNRT
LPDLSEVGPFHGQPLGPGLRPGEDPKGPFGRSFSTSRLTDLLLKAAFGTQAPDPGSTESL
QEKPMEIAPSAGFGGSLHPGARAGGTSSPSPVVFTVGSPPSGSTPPQGPRTRMFSAGPTG
SASSSARHLVPGPCSEAPAPELPAPGHGCSFADPIAANLEGAVTFEAPDLPEETLMEQEH
TEILRGLRFTLLFVQHVLEIAALKGSASEAAGGPEYQLQESVVADQISLLSREWGFAEQL
VLYLKVAELLSSGLQSAIDQIRAGKLCLSSTVKQVVRRLNELYKASVVSCQGLSLRLQRF
FLDKQRLLDRIHSITAERLIFSHAVQMVQSAALDEMFQHREGCVPRYHKALLLLEGLQHM
LSDQADIENVTKCKLCIERRLSALLTGICA
GenBank ID Protein 4507831
UniProtKB/Swiss-Prot ID O75385
UniProtKB/Swiss-Prot Entry Name ULK1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_003565.2
GeneCard ID ULK1
GenAtlas ID ULK1
HGNC ID HGNC:12558
References
General References
  1. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  2. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  5. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  6. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  7. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. [PubMed:16541075 ]
  8. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  9. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  10. Nagase T, Ishikawa K, Suyama M, Kikuno R, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Oct 30;5(5):277-86. [PubMed:9872452 ]
  11. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  12. Wissing J, Jansch L, Nimtz M, Dieterich G, Hornberger R, Keri G, Wehland J, Daub H: Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry. Mol Cell Proteomics. 2007 Mar;6(3):537-47. Epub 2006 Dec 27. [PubMed:17192257 ]
  13. Kuroyanagi H, Yan J, Seki N, Yamanouchi Y, Suzuki Y, Takano T, Muramatsu M, Shirasawa T: Human ULK1, a novel serine/threonine kinase related to UNC-51 kinase of Caenorhabditis elegans: cDNA cloning, expression, and chromosomal assignment. Genomics. 1998 Jul 1;51(1):76-85. [PubMed:9693035 ]
  14. Okazaki N, Yan J, Yuasa S, Ueno T, Kominami E, Masuho Y, Koga H, Muramatsu M: Interaction of the Unc-51-like kinase and microtubule-associated protein light chain 3 related proteins in the brain: possible role of vesicular transport in axonal elongation. Brain Res Mol Brain Res. 2000 Dec 28;85(1-2):1-12. [PubMed:11146101 ]
  15. Hosokawa N, Sasaki T, Iemura S, Natsume T, Hara T, Mizushima N: Atg101, a novel mammalian autophagy protein interacting with Atg13. Autophagy. 2009 Oct;5(7):973-9. Epub 2009 Oct 18. [PubMed:19597335 ]
  16. Hosokawa N, Hara T, Kaizuka T, Kishi C, Takamura A, Miura Y, Iemura S, Natsume T, Takehana K, Yamada N, Guan JL, Oshiro N, Mizushima N: Nutrient-dependent mTORC1 association with the ULK1-Atg13-FIP200 complex required for autophagy. Mol Biol Cell. 2009 Apr;20(7):1981-91. doi: 10.1091/mbc.E08-12-1248. Epub 2009 Feb 11. [PubMed:19211835 ]
  17. Chan EY, Longatti A, McKnight NC, Tooze SA: Kinase-inactivated ULK proteins inhibit autophagy via their conserved C-terminal domains using an Atg13-independent mechanism. Mol Cell Biol. 2009 Jan;29(1):157-71. doi: 10.1128/MCB.01082-08. Epub 2008 Oct 20. [PubMed:18936157 ]