You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01368
Secondary Accession Numbers
  • 6664
Name Ephrin type-A receptor 3
Synonyms
  1. EK4
  2. EPH-like kinase 4
  3. HEK
  4. Tyrosine-protein kinase TYRO4
  5. Tyrosine-protein kinase receptor ETK1
  6. hEK4
Gene Name EPHA3
Protein Type Enzyme
Biological Properties
General Function Involved in ephrin receptor activity
Specific Function Receptor for members of the ephrin-A family. Binds to ephrin-A2, -A3, -A4 and -A5. Could play a role in lymphoid function
Pathways Not Available
Reactions Not Available
GO Classification
Component
integral to plasma membrane
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
protein tyrosine kinase activity
transmembrane receptor protein tyrosine kinase activity
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
ephrin receptor activity
protein binding
protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
enzyme linked receptor protein signaling pathway
transmembrane receptor protein tyrosine kinase signaling pathway
metabolic process
cellular metabolic process
protein amino acid phosphorylation
signaling
signaling pathway
cell surface receptor linked signaling pathway
phosphorylation
Cellular Location
  1. Isoform 2:Secreted
Gene Properties
Chromosome Location Chromosome:3
Locus 3p11.2
SNPs EPHA3
Gene Sequence
>2952 bp
ATGGATTGTCAGCTCTCCATCCTCCTCCTTCTCAGCTGCTCTGTTCTCGACAGCTTCGGG
GAACTGATTCCGCAGCCTTCCAATGAAGTCAATCTACTGGATTCAAAAACAATTCAAGGG
GAGCTGGGCTGGATCTCTTATCCATCACATGGGTGGGAAGAGATCAGTGGTGTGGATGAA
CATTACACACCCATCAGGACTTACCAGGTGTGCAATGTCATGGACCACAGTCAAAACAAT
TGGCTGAGAACAAACTGGGTCCCCAGGAACTCAGCTCAGAAGATTTATGTGGAGCTCAAG
TTCACTCTACGAGACTGCAATAGCATTCCATTGGTTTTAGGAACTTGCAAGGAGACATTC
AACCTGTACTACATGGAGTCTGATGATGATCATGGGGTGAAATTTCGAGAGCATCAGTTT
ACAAAGATTGACACCATTGCAGCTGATGAAAGTTTCACTCAAATGGATCTTGGGGACCGT
ATTCTGAAGCTCAACACTGAGATTAGAGAAGTAGGTCCTGTCAACAAGAAGGGATTTTAT
TTGGCATTTCAAGATGTTGGTGCTTGTGTTGCCTTGGTGTCTGTGAGAGTATACTTCAAA
AAGTGCCCATTTACAGTGAAGAATCTGGCTATGTTTCCAGACACGGTACCCATGGACTCC
CAGTCCCTGGTGGAGGTTAGAGGGTCTTGTGTCAACAATTCTAAGGAGGAAGATCCTCCA
AGGATGTACTGCAGTACAGAAGGCGAATGGCTTGTACCCATTGGCAAGTGTTCCTGCAAT
GCTGGCTATGAAGAAAGAGGTTTTATGTGCCAAGCTTGTCGACCAGGTTTCTACAAGGCA
TTGGATGGTAATATGAAGTGTGCTAAGTGCCCGCCTCACAGTTCTACTCAGGAAGATGGT
TCAATGAACTGCAGGTGTGAGAATAATTACTTCCGGGCAGACAAAGACCCTCCATCCATG
GCTTGTACCCGACCTCCATCTTCACCAAGAAATGTTATCTCTAATATAAACGAGACCTCA
GTTATCCTGGACTGGAGTTGGCCCCTGGACACAGGAGGCCGGAAAGATGTTACCTTCAAC
ATCATATGTAAAAAATGTGGGTGGAATATAAAACAGTGTGAGCCATGCAGCCCAAATGTC
CGCTTCCTCCCTCGACAGTTTGGACTCACCAACACCACGGTGACAGTGACAGACCTTCTG
GCACATACTAACTACACCTTTGAGATTGATGCCGTTAATGGGGTGTCAGAGCTGAGCTCC
CCACCAAGACAGTTTGCTGCGGTCAGCATCACAACTAATCAGGCTGCTCCATCACCTGTC
CTGACGATTAAGAAAGATCGGACCTCCAGAAATAGCATCTCTTTGTCCTGGCAAGAACCT
GAACATCCTAATGGGATCATATTGGACTACGAGGTCAAATACTATGAAAAGCAGGAACAA
GAAACAAGTTATACCATTCTGAGGGCAAGAGGCACAAATGTTACCATCAGTAGCCTCAAG
CCTGACACTATATACGTATTCCAAATCCGAGCCCGAACAGCCGCTGGATATGGGACGAAC
AGCCGCAAGTTTGAGTTTGAAACTAGTCCAGACTCTTTCTCCATCTCTGGTGAAAGTAGC
CAAGTGGTCATGATCGCCATTTCAGCGGCAGTAGCAATTATTCTCCTCACTGTTGTCATC
TATGTTTTGATTGGGAGGTTCTGTGGCTATAAGTCAAAACATGGGGCAGATGAAAAAAGA
CTTCATTTTGGCAATGGGCATTTAAAACTTCCAGGTCTCAGGACTTATGTTGACCCACAT
ACATATGAAGACCCTACCCAAGCTGTTCATGAGTTTGCCAAGGAATTGGATGCCACCAAC
ATATCCATTGATAAAGTTGTTGGAGCAGGTGAATTTGGAGAGGTGTGCAGTGGTCGCTTA
AAACTTCCTTCAAAAAAAGAGATTTCAGTGGCCATTAAGACCCTGAAAGTTGGCTACACA
GAAAAGCAGAGGAGAGACTTCCTGGGAGAAGCAAGCATTATGGGACAGTTTGACCACCCC
AATATCATTCGACTGGAAGGAGTTGTTACCAAAAGTAAGCCAGTTATGATTGTCACAGAA
TACATGGAGAATGGTTCCTTGGATAGTTTCCTACGTAAACACGATGCCCAGTTTACTGTC
ATTCAGCTAGTGGGGATGCTTCGAGGGATAGCATCTGGCATGAAGTACCTGTCAGACATG
GGCTATGTTCACCGAGACCTCGCTGCTCGGAACATCTTGATCAACAGTAACTTGGTGTGT
AAGGTTTCTGATTTCGGACTTTCGCGTGTCCTGGAGGATGACCCAGAAGCTGCTTATACA
ACAAGAGGAGGGAAGATCCCAATCAGGTGGACATCACCAGAAGCTATAGCCTACCGCAAG
TTCACGTCAGCCAGCGATGTATGGAGTTATGGGATTGTTCTCTGGGAGGTGATGTCTTAT
GGAGAGAGACCATACTGGGAGATGTCCAATCAGGATGTAATTAAAGCTGTAGATGAGGGC
TATCGACTGCCACCCCCCATGGACTGCCCAGCTGCCTTGTATCAGCTGATGCTGGACTGC
TGGCAGAAAGACAGGAACAACAGACCCAAGTTTGAGCAGATTGTTAGTATTCTGGACAAG
CTTATCCGGAATCCCGGCAGCCTGAAGATCATCACCAGTGCAGCCGCAAGGCCATCAAAC
CTTCTTCTGGACCAAAGCAATGTGGATATCACTACCTTCCGCACAACAGGTGACTGGCTT
AATGGTGTCTGGACAGCACACTGCAAGGAAATCTTCACGGGTGTGGAGTACAGTTCTTGT
GACACAATAGCCAAGATTTCCACAGATGACATGAAAAAGGTTGGTGTCACCGTGGTTGGG
CCACAGAAGAAGATCATCAGTAGCATTAAAGCTCTAGAAACGCAATCAAAGAATGGCCCA
GTTCCCGTGTAA
Protein Properties
Number of Residues 983
Molecular Weight 110129.7
Theoretical pI 6.73
Pfam Domain Function
Signals
  • 1-20
Transmembrane Regions
  • 542-565
Protein Sequence
>Ephrin type-A receptor 3
MDCQLSILLLLSCSVLDSFGELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDE
HYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETF
NLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFY
LAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPP
RMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDG
SMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLDTGGRKDVTFN
IICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSS
PPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQ
ETSYTILRARGTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESS
QVVMIAISAAVAIILLTVVIYVLIGRFCGYKSKHGADEKRLHFGNGHLKLPGLRTYVDPH
TYEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYT
EKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTV
IQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYT
TRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEG
YRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSN
LLLDQSNVDITTFRTTGDWLNGVWTAHCKEIFTGVEYSSCDTIAKISTDDMKKVGVTVVG
PQKKIISSIKALETQSKNGPVPV
GenBank ID Protein 12003435
UniProtKB/Swiss-Prot ID P29320
UniProtKB/Swiss-Prot Entry Name EPHA3_HUMAN
PDB IDs Not Available
GenBank Gene ID AF213459
GeneCard ID EPHA3
GenAtlas ID EPHA3
HGNC ID HGNC:3387
References
General References
  1. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  2. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  3. Hillman RT, Green RE, Brenner SE: An unappreciated role for RNA surveillance. Genome Biol. 2004;5(2):R8. Epub 2004 Feb 2. [PubMed:14759258 ]
  4. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  5. Wissing J, Jansch L, Nimtz M, Dieterich G, Hornberger R, Keri G, Wehland J, Daub H: Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry. Mol Cell Proteomics. 2007 Mar;6(3):537-47. Epub 2006 Dec 27. [PubMed:17192257 ]
  6. Wicks IP, Wilkinson D, Salvaris E, Boyd AW: Molecular cloning of HEK, the gene encoding a receptor tyrosine kinase expressed by human lymphoid tumor cell lines. Proc Natl Acad Sci U S A. 1992 Mar 1;89(5):1611-5. [PubMed:1311845 ]
  7. Chiari R, Hames G, Stroobant V, Texier C, Maillere B, Boon T, Coulie PG: Identification of a tumor-specific shared antigen derived from an Eph receptor and presented to CD4 T cells on HLA class II molecules. Cancer Res. 2000 Sep 1;60(17):4855-63. [PubMed:10987298 ]
  8. Boyd AW, Ward LD, Wicks IP, Simpson RJ, Salvaris E, Wilks A, Welch K, Loudovaris M, Rockman S, Busmanis I: Isolation and characterization of a novel receptor-type protein tyrosine kinase (hek) from a human pre-B cell line. J Biol Chem. 1992 Feb 15;267(5):3262-7. [PubMed:1737782 ]