You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01370
Secondary Accession Numbers
  • 6666
Name Tyrosine-protein kinase Tec
Synonyms Not Available
Gene Name TEC
Protein Type Unknown
Biological Properties
General Function Involved in protein kinase activity
Specific Function ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
protein tyrosine kinase activity
non-membrane spanning protein tyrosine kinase activity
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein binding
protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
signaling process
signal transmission
cellular metabolic process
protein amino acid phosphorylation
intracellular signaling pathway
signaling
signaling pathway
phosphorylation
signal transmission via phosphorylation event
intracellular protein kinase cascade
Cellular Location
  1. Cytoplasm (Probable)
Gene Properties
Chromosome Location Chromosome:4
Locus 4p12
SNPs TEC
Gene Sequence
>1896 bp
ATGAATTTTAACACTATTTTGGAGGAGATTCTTATTAAAAGGTCACAGCAGAAAAAGAAG
ACATCGCCCTTAAACTACAAAGAGAGACTTTTTGTACTTACAAAGTCCATGCTAACCTAC
TATGAGGGTCGAGCAGAGAAGAAATACAGAAAGGGGTTTATTGATGTTTCAAAAATCAAG
TGTGTGGAAATAGTGAAGAATGATGATGGTGTCATTCCCTGTCAAAATAAGTATCCATTT
CAGGTTGTTCATGATGCTAACACACTTTACATTTTTGCACCTAGTCCACAAAGCAGGGAC
CTGTGGGTGAAGAAGTTAAAAGAAGAAATAAAGAACAACAATAATATTATGATTAAATAT
CATCCTAAATTCTGGACAGATGGAAGTTATCAGTGTTGTAGACAAACTGAAAAATTAGCA
CCCGGATGTGAAAAATACAATCTTTTTGAGAGCAGTATAAGAAAAGCACTACCTCCAGCA
CCAGAAACAAAGAAGCGAAGGCCTCCCCCACCAATTCCACTAGAAGAAGAAGATAATAGT
GAAGAAATCGTTGTAGCCATGTATGATTTCCAAGCAGCAGAAGGACATGATCTCAGATTA
GAGAGAGGCCAAGAGTATCTCATTTTAGAAAAGAATGATGTTCATTGGTGGAGAGCAAGA
GATAAATATGGGAATGAAGGATATATCCCAAGTAATTACGTAACGGGAAAGAAATCAAAC
AACTTAGATCAATATGAATGGTATTGCAGAAATATGAATAGAAGCAAGGCAGAGCAACTC
CTCCGCAGTGAAGATAAAGAAGGTGGTTTTATGGTAAGGGATTCCAGTCAACCAGGCTTG
TACACAGTCTCCCTTTATACCAAGTTTGGAGGAGAAGGTTCATCGGGTTTTAGGCATTAT
CATATAAAGGAAACAACAACATCTCCAAAGAAGTATTACCTAGCTGAAAAACATGCTTTT
GGCTCCATTCCTGAGATTATTGAATATCATAAGCACAATGCAGCAGGACTTGTCACCAGG
CTTCGGTACCCAGTTAGTGTGAAAGGGAAGAATGCACCCACCACTGCAGGATTCAGCTAT
GAGAAATGGGAGATTAACCCTTCAGAACTGACCTTTATGAGGGAATTGGGAAGTGGACTG
TTTGGAGTGGTGAGGCTTGGCAAATGGCGAGCCCAGTACAAAGTCGCAATCAAAGCTATT
CGGGAAGGTGCAATGTGCGAGGAGGACTTTATAGAAGAAGCTAAAGTGATGATGAAACTG
ACACACCCGAAGTTAGTGCAGCTTTATGGTGTGTGCACCCAGCAGAAACCAATATACATT
GTTACTGAGTTCATGGAAAGGGGCTGCCTTCTGAATTTCCTCCGACAGAGACAAGGTCAT
TTCAGTAGAGACGTACTGCTGAGCATGTGTCAGGATGTGTGTGAAGGGATGGAGTATCTG
GAGAGAAACAGCTTCATCCACAGAGATCTGGCTGCCAGAAATTGTCTAGTAAGTGAGGCG
GGAGTTGTAAAAGTATCTGATTTTGGAATGGCCAGGTATGTTCTGGATGATCAGTACACA
AGTTCTTCTGGTGCTAAGTTTCCTGTGAAGTGGTGTCCACCTGAAGTGTTTAATTACAGC
CGCTTCAGCAGCAAATCAGATGTCTGGTCATTTGGTGTTTTAATGTGGGAAGTATTCACG
GAAGGCAGAATGCCTTTTGAAAAATACACCAATTATGAAGTGGTAACCATGGTTACTCGA
GGCCACCGACTCTACCAGCCGAAGTTGGCGTCCAACTATGTGTATGAGGTGATGCTGAGA
TGTTGGCAGGAGAAACCAGAGGGAAGGCCTTCTTTCGAAGATCTGCTGCGCACAATAGAT
GAACTAGTTGAATGTGAAGAAACTTTTGGAAGATAA
Protein Properties
Number of Residues 631
Molecular Weight 73580.7
Theoretical pI 8.58
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Tyrosine-protein kinase Tec
MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIK
CVEIVKNDDGVIPCQNKYPFQVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKY
HPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIRKALPPAPETKKRRPPPPIPLEEEDNS
EEIVVAMYDFQAAEGHDLRLERGQEYLILEKNDVHWWRARDKYGNEGYIPSNYVTGKKSN
NLDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHY
HIKETTTSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSVKGKNAPTTAGFSY
EKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKL
THPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDVLLSMCQDVCEGMEYL
ERNSFIHRDLAARNCLVSEAGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYS
RFSSKSDVWSFGVLMWEVFTEGRMPFEKYTNYEVVTMVTRGHRLYQPKLASNYVYEVMLR
CWQEKPEGRPSFEDLLRTIDELVECEETFGR
GenBank ID Protein 75517224
UniProtKB/Swiss-Prot ID P42680
UniProtKB/Swiss-Prot Entry Name TEC_HUMAN
PDB IDs Not Available
GenBank Gene ID BC101711
GeneCard ID TEC
GenAtlas ID TEC
HGNC ID HGNC:11719
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  3. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  4. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  5. Nore BF, Mattsson PT, Antonsson P, Backesjo CM, Westlund A, Lennartsson J, Hansson H, Low P, Ronnstrand L, Smith CI: Identification of phosphorylation sites within the SH3 domains of Tec family tyrosine kinases. Biochim Biophys Acta. 2003 Feb 21;1645(2):123-32. [PubMed:12573241 ]
  6. Sato K, Mano H, Ariyama T, Inazawa J, Yazaki Y, Hirai H: Molecular cloning and analysis of the human Tec protein-tyrosine kinase. Leukemia. 1994 Oct;8(10):1663-72. [PubMed:7934162 ]
  7. Tomlinson MG, Heath VL, Turck CW, Watson SP, Weiss A: SHIP family inositol phosphatases interact with and negatively regulate the Tec tyrosine kinase. J Biol Chem. 2004 Dec 31;279(53):55089-96. Epub 2004 Oct 18. [PubMed:15492005 ]