You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01378
Secondary Accession Numbers
  • 6674
Name Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase
Synonyms
  1. Myt1 kinase
Gene Name PKMYT1
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase activity
Specific Function Acts as a negative regulator of entry into mitosis (G2 to M transition) by phosphorylation of the CDK1 kinase specifically when CDK1 is complexed to cyclins. Mediates phosphorylation of CDK1 predominantly on 'Thr-14'. Also involved in Golgi fragmentation. May be involved in phosphorylation of CDK1 on 'Tyr-15' to a lesser degree, however tyrosine kinase activity is unclear and may be indirect. May be a downstream target of Notch signaling pathway during eye development
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular process
cellular metabolic process
cell cycle
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Golgi apparatus membrane
  2. Peripheral membrane protein
  3. Peripheral membrane protein
  4. Endoplasmic reticulum membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 16p13.3
SNPs PKMYT1
Gene Sequence
>1500 bp
ATGCTAGAACGGCCTCCTGCACTGGCCATGCCCATGCCCACGGAGGGCACCCCGCCACCT
CTGAGTGGCACCCCCATCCCAGTCCCAGCCTACTTCCGCCACGCAGAACCTGGATTCTCC
CTCAAGAGGCCCAGGGGGCTCAGCCGGAGCCTCCCACCTCCGCCCCCTGCCAAGGGCAGC
ATTCCCATCAGCCGCCTCTTCCCTCCTCGGACCCCAGGCTGGCACCAGCTGCAGCCCCGG
CGGGTGTCATTCCGGGGCGAGGCCTCAGAGACTCTGCAGAGCCCTGGGTATGACCCAAGC
CGGCCAGAGTCCTTCTTCCAGCAGAGCTTCCAGAGGCTCAGCCGCCTGGGCCATGGCTCC
TACGGAGAGGTCTTCAAGGTGCGCTCCAAGGAGGACGGCCGGCTCTATGCGGTAAAGCGT
TCCATGTCACCATTCCGGGGCCCCAAGGACCGGGCCCGCAAGTTGGCCGAGGTGGGCAGC
CACGAGAAGGTGGGGCAGCACCCATGCTGCGTGCGGCTGGAGCAGGCCTGGGAGGAGGGC
GGCATCCTGTACCTGCAGACGGAGCTGTGCGGGCCCAGCCTGCAGCAACACTGTGAGGCC
TGGGGTGCCAGCCTGCCTGAGGCCCAGGTCTGGGGCTACCTGCGGGACACGCTGCTTGCC
CTGGCCCATCTGCACAGCCAGGGCCTGGTGCACCTTGATGTCAAGCCTGCCAACATCTTC
CTGGGGCCCCGGGGCCGCTGCAAGCTGGGTGACTTCGGACTGCTGGTGGAGCTGGGTACA
GCAGGAGCTGGTGAGGTCCAGGAGGGAGACCCCCGCTACATGGCCCCCGAGCTGCTGCAG
GGCTCCTATGGGACAGCAGCGGATGTGTTCAGTCTGGGCCTCACCATCCTGGAAGTGGCA
TGCAACATGGAGCTGCCCCACGGTGGGGAGGGCTGGCAGCAGCTGCGCCAGGGCTACCTG
CCCCCTGAGTTCACTGCCGGTCTGTCTTCCGAGCTGCGTTCTGTCCTTGTCATGATGCTG
GAGCCAGACCCCAAGCTGCGGGCCACGGCCGAGGCCCTGCTGGCACTGCCTGTGTTGAGG
CAGCCGCGGGCCTGGGGTGTGCTGTGGTGCATGGCAGCGGAGGCCCTGAGCCGAGGGTGG
GCCCTGTGGCAGGCCCTGCTTGCCCTGCTCTGCTGGCTCTGGCATGGGCTGGCTCACCCT
GCCAGCTGGCTACAGCCCCTGGGCCCGCCAGCCACCCCGCCTGGCTCACCACCCTGCAGT
TTGCTCCTGGACAGCAGCCTCTCCAGCAACTGGGATGACGACAGCCTAGGGCCTTCACTC
TCCCCTGAGGCTGTCCTGGCCCGGACTGTGGGGAGCACCTCCACCCCCCGGAGCAGGTGC
ACACCCAGGGATGCCCTGGACCTAAGTGACATCAACTCAGAGCCTCCTCGGGGCTCCTTC
CCCTCCTTTGAGCCTCGGAACCTCCTCAGCCTGTTTGAGGACACCCTAGACCCAACCTGA
Protein Properties
Number of Residues 499
Molecular Weight 54520.8
Theoretical pI 6.93
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase
MLERPPALAMPMPTEGTPPPLSGTPIPVPAYFRHAEPGFSLKRPRGLSRSLPPPPPAKGS
IPISRLFPPRTPGWHQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGS
YGEVFKVRSKEDGRLYAVKRSMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEG
GILYLQTELCGPSLQQHCEAWGASLPEAQVWGYLRDTLLALAHLHSQGLVHLDVKPANIF
LGPRGRCKLGDFGLLVELGTAGAGEVQEGDPRYMAPELLQGSYGTAADVFSLGLTILEVA
CNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATAEALLALPVLR
QPRAWGVLWCMAAEALSRGWALWQALLALLCWLWHGLAHPASWLQPLGPPATPPGSPPCS
LLLDSSLSSNWDDDSLGPSLSPEAVLARTVGSTSTPRSRCTPRDALDLSDINSEPPRGSF
PSFEPRNLLSLFEDTLDPT
GenBank ID Protein 2914674
UniProtKB/Swiss-Prot ID Q99640
UniProtKB/Swiss-Prot Entry Name PMYT1_HUMAN
PDB IDs Not Available
GenBank Gene ID AC004233
GeneCard ID PKMYT1
GenAtlas ID PKMYT1
HGNC ID HGNC:29650
References
General References
  1. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  2. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M, Couronne O, Aerts A, Bajorek E, Black S, Blumer H, Branscomb E, Brown NC, Bruno WJ, Buckingham JM, Callen DF, Campbell CS, Campbell ML, Campbell EW, Caoile C, Challacombe JF, Chasteen LA, Chertkov O, Chi HC, Christensen M, Clark LM, Cohn JD, Denys M, Detter JC, Dickson M, Dimitrijevic-Bussod M, Escobar J, Fawcett JJ, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Goodwin LA, Grady DL, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Hildebrand CE, Huang W, Israni S, Jett J, Jewett PB, Kadner K, Kimball H, Kobayashi A, Krawczyk MC, Leyba T, Longmire JL, Lopez F, Lou Y, Lowry S, Ludeman T, Manohar CF, Mark GA, McMurray KL, Meincke LJ, Morgan J, Moyzis RK, Mundt MO, Munk AC, Nandkeshwar RD, Pitluck S, Pollard M, Predki P, Parson-Quintana B, Ramirez L, Rash S, Retterer J, Ricke DO, Robinson DL, Rodriguez A, Salamov A, Saunders EH, Scott D, Shough T, Stallings RL, Stalvey M, Sutherland RD, Tapia R, Tesmer JG, Thayer N, Thompson LS, Tice H, Torney DC, Tran-Gyamfi M, Tsai M, Ulanovsky LE, Ustaszewska A, Vo N, White PS, Williams AL, Wills PL, Wu JR, Wu K, Yang J, Dejong P, Bruce D, Doggett NA, Deaven L, Schmutz J, Grimwood J, Richardson P, Rokhsar DS, Eichler EE, Gilna P, Lucas SM, Myers RM, Rubin EM, Pennacchio LA: The sequence and analysis of duplication-rich human chromosome 16. Nature. 2004 Dec 23;432(7020):988-94. [PubMed:15616553 ]
  5. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  6. Wissing J, Jansch L, Nimtz M, Dieterich G, Hornberger R, Keri G, Wehland J, Daub H: Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry. Mol Cell Proteomics. 2007 Mar;6(3):537-47. Epub 2006 Dec 27. [PubMed:17192257 ]
  7. Nousiainen M, Sillje HH, Sauer G, Nigg EA, Korner R: Phosphoproteome analysis of the human mitotic spindle. Proc Natl Acad Sci U S A. 2006 Apr 4;103(14):5391-6. Epub 2006 Mar 24. [PubMed:16565220 ]
  8. Booher RN, Holman PS, Fattaey A: Human Myt1 is a cell cycle-regulated kinase that inhibits Cdc2 but not Cdk2 activity. J Biol Chem. 1997 Aug 29;272(35):22300-6. [PubMed:9268380 ]
  9. Liu F, Stanton JJ, Wu Z, Piwnica-Worms H: The human Myt1 kinase preferentially phosphorylates Cdc2 on threonine 14 and localizes to the endoplasmic reticulum and Golgi complex. Mol Cell Biol. 1997 Feb;17(2):571-83. [PubMed:9001210 ]
  10. Shen M, Stukenberg PT, Kirschner MW, Lu KP: The essential mitotic peptidyl-prolyl isomerase Pin1 binds and regulates mitosis-specific phosphoproteins. Genes Dev. 1998 Mar 1;12(5):706-20. [PubMed:9499405 ]
  11. Wells NJ, Watanabe N, Tokusumi T, Jiang W, Verdecia MA, Hunter T: The C-terminal domain of the Cdc2 inhibitory kinase Myt1 interacts with Cdc2 complexes and is required for inhibition of G(2)/M progression. J Cell Sci. 1999 Oct;112 ( Pt 19):3361-71. [PubMed:10504341 ]
  12. Liu F, Rothblum-Oviatt C, Ryan CE, Piwnica-Worms H: Overproduction of human Myt1 kinase induces a G2 cell cycle delay by interfering with the intracellular trafficking of Cdc2-cyclin B1 complexes. Mol Cell Biol. 1999 Jul;19(7):5113-23. [PubMed:10373560 ]
  13. Nakajima H, Toyoshima-Morimoto F, Taniguchi E, Nishida E: Identification of a consensus motif for Plk (Polo-like kinase) phosphorylation reveals Myt1 as a Plk1 substrate. J Biol Chem. 2003 Jul 11;278(28):25277-80. Epub 2003 May 8. [PubMed:12738781 ]