You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01391
Secondary Accession Numbers
  • 6687
Name Tyrosine-protein kinase Fgr
Synonyms
  1. Proto-oncogene c-Fgr
  2. p55-Fgr
Gene Name FGR
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase activity
Specific Function ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate
Pathways Not Available
Reactions Not Available
GO Classification
Function
protein tyrosine kinase activity
non-membrane spanning protein tyrosine kinase activity
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein binding
protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 1p36.2-p36.1
SNPs FGR
Gene Sequence
>1590 bp
ATGGGCTGTGTGTTCTGCAAGAAATTGGAGCCGGTGGCCACGGCCAAGGAGGATGCTGGC
CTGGAAGGGGACTTCAGAAGCTACGGGGCAGCAGACCACTATGGGCCTGACCCCACTAAG
GCCCGGCCTGCATCCTCATTTGCCCACATCCCCAACTACAGCAACTTCTCCTCTCAGGCC
ATCAACCCTGGCTTCCTTGATAGTGGCACCATCAGGGGTGTGTCAGGGATTGGGGTGACC
CTGTTCATTGCCCTGTATGACTATGAGGCTCGAACTGAGGATGACCTCACCTTCACCAAG
GGCGAGAAGTTCCACATCCTGAACAATACTGAAGGTGACTGGTGGGAGGCTCGGTCTCTC
AGCTCCGGAAAAACTGGCTGCATTCCCAGCAACTACGTGGCCCCTGTTGACTCAATCCAA
GCTGAAGAGTGGTACTTTGGAAAGATTGGGAGAAAGGATGCAGAGAGGCAGCTGCTTTCA
CCAGGCAACCCCCAGGGGGCCTTTCTCATTCGGGAAAGCGAGACCACCAAAGGTGCCTAC
TCCCTGTCCATCCGGGACTGGGATCAGACCAGAGGCGATCATGTGAAGCATTACAAGATC
CGCAAACTGGACATGGGCGGCTACTACATCACCACACGGGTTCAGTTCAACTCGGTGCAG
GAGCTGGTGCAGCACTACATGGAGGTGAATGACGGGCTGTGCAACCTGCTCATCGCGCCC
TGCACCATCATGAAGCCGCAGACGCTGGGCCTGGCCAAGGACGCCTGGGAGATCAGCCGC
AGCTCCATCACGCTGGAGCGCCGGCTGGGCACCGGCTGCTTCGGGGATGTGTGGCTGGGC
ACGTGGAACGGCAGCACTAAGGTGGCGGTGAAGACGCTGAAGCCGGGCACCATGTCCCCG
AAGGCCTTCCTGGAGGAGGCGCAGGTCATGAAGCTGCTGCGGCACGACAAGCTGGTGCAG
CTGTACGCCGTGGTGTCGGAGGAGCCCATCTACATCGTGACCGAGTTCATGTGTCACGGC
AGCTTGCTGGATTTTCTCAAGAACCCAGAGGGCCAGGATTTGAGGCTGCCCCAATTGGTG
GACATGGCAGCCCAGGTAGCTGAGGGCATGGCCTACATGGAACGCATGAACTACATTCAC
CGCGACCTGAGGGCAGCCAACATCCTGGTTGGGGAGCGGCTGGCGTGCAAGATCGCAGAC
TTTGGCTTGGCGCGTCTCATCAAGGACGATGAGTACAACCCCTGCCAAGGTTCCAAGTTC
CCCATCAAGTGGACAGCCCCAGAAGCTGCCCTCTTTGGCAGATTCACCATCAAGTCAGAC
GTGTGGTCCTTTGGGATCCTGCTCACTGAGCTCATCACCAAGGGCCGAATCCCCTACCCA
GGCATGAATAAACGGGAAGTGTTGGAACAGGTGGAGCAGGGCTACCACATGCCGTGCCCT
CCAGGCTGCCCAGCATCCCTGTACGAGGCCATGGAACAGACCTGGCGTCTGGACCCGGAG
GAGAGGCCTACCTTCGAGTACCTGCAGTCCTTCCTGGAGGACTACTTCACCTCCGCTGAA
CCACAGTACCAGCCCGGGGATCAGACATAG
Protein Properties
Number of Residues 529
Molecular Weight 59478.1
Theoretical pI 5.29
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Tyrosine-protein kinase Fgr
MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQA
INPGFLDSGTIRGVSGIGVTLFIALYDYEARTEDDLTFTKGEKFHILNNTEGDWWEARSL
SSGKTGCIPSNYVAPVDSIQAEEWYFGKIGRKDAERQLLSPGNPQGAFLIRESETTKGAY
SLSIRDWDQTRGDHVKHYKIRKLDMGGYYITTRVQFNSVQELVQHYMEVNDGLCNLLIAP
CTIMKPQTLGLAKDAWEISRSSITLERRLGTGCFGDVWLGTWNGSTKVAVKTLKPGTMSP
KAFLEEAQVMKLLRHDKLVQLYAVVSEEPIYIVTEFMCHGSLLDFLKNPEGQDLRLPQLV
DMAAQVAEGMAYMERMNYIHRDLRAANILVGERLACKIADFGLARLIKDDEYNPCQGSKF
PIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMNKREVLEQVEQGYHMPCP
PGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQT
GenBank ID Protein 6572192
UniProtKB/Swiss-Prot ID P09769
UniProtKB/Swiss-Prot Entry Name FGR_HUMAN
PDB IDs Not Available
GenBank Gene ID AL031729
GeneCard ID FGR
GenAtlas ID FGR
HGNC ID HGNC:3697
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  4. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  5. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  6. Katamine S, Notario V, Rao CD, Miki T, Cheah MS, Tronick SR, Robbins KC: Primary structure of the human fgr proto-oncogene product p55c-fgr. Mol Cell Biol. 1988 Jan;8(1):259-66. [PubMed:3275868 ]
  7. Brickell PM, Patel M: Structure and expression of c-fgr protooncogene mRNA in Epstein-Barr virus converted cell lines. Br J Cancer. 1988 Dec;58(6):704-9. [PubMed:2852026 ]
  8. Inoue K, Ikawa S, Semba K, Sukegawa J, Yamamoto T, Toyoshima K: Isolation and sequencing of cDNA clones homologous to the v-fgr oncogene from a human B lymphocyte cell line, IM-9. Oncogene. 1987;1(3):301-4. [PubMed:3330776 ]
  9. Patel M, Leevers SJ, Brickell PM: Structure of the complete human c-fgr proto-oncogene and identification of multiple transcriptional start sites. Oncogene. 1990 Feb;5(2):201-6. [PubMed:1690869 ]
  10. Nishizawa M, Semba K, Yoshida MC, Yamamoto T, Sasaki M, Toyoshima K: Structure, expression, and chromosomal location of the human c-fgr gene. Mol Cell Biol. 1986 Feb;6(2):511-7. [PubMed:3023853 ]