You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01408
Secondary Accession Numbers
  • 6704
Name 5-formyltetrahydrofolate cyclo-ligase
Synonyms
  1. 5,10-methenyl-tetrahydrofolate synthetase
  2. MTHFS
  3. Methenyl-THF synthetase
Gene Name MTHFS
Protein Type Unknown
Biological Properties
General Function Involved in ATP binding
Specific Function Contributes to tetrahydrofolate metabolism. Helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids.
Pathways
  • Folate malabsorption, hereditary
  • Folate Metabolism
  • Methotrexate Pathway
  • Methylenetetrahydrofolate Reductase Deficiency (MTHFRD)
  • One carbon pool by folate
Reactions
Adenosine triphosphate + Folinic acid → ADP + Phosphoric acid + 5,10-Methenyltetrahydrofolic acid details
Adenosine triphosphate + Folinic acid + Hydrogen Ion → ADP + Phosphoric acid + 5,10-Methenyltetrahydrofolic acid details
GO Classification
Biological Process
folic acid-containing compound biosynthetic process
formate metabolic process
tetrahydrofolate metabolic process
Cellular Component
cytosol
plasma membrane
Golgi apparatus
Function
binding
catalytic activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
ligase activity
cyclo-ligase activity
5-formyltetrahydrofolate cyclo-ligase activity
ligase activity, forming carbon-nitrogen bonds
Molecular Function
5-formyltetrahydrofolate cyclo-ligase activity
ATP binding
folic acid binding
Process
metabolic process
cellular aromatic compound metabolic process
folic acid and derivative metabolic process
cellular metabolic process
folic acid and derivative biosynthetic process
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 15
Locus 15q25.1
SNPs MTHFS
Gene Sequence
>612 bp
ATGGCGGCGGCAGCGGTGAGCAGCGCCAAGCGTAGCCTGCGGGGAGAGCTGAAGCAGCGT
CTGCGGGCGATGAGTGCCGAGGAGCGGCTACGCCAGTCCCGCGTACTGAGCCAGAAGGTG
ATTGCCCACAGTGAGTATCAAAAGTCCAAAAGAATTTCCATCTTTCTGAGCATGCAAGAT
GAAATTGAGACAGAAGAGATCATCAAGGACATTTTCCAACGAGGCAAAATCTGCTTCATC
CCTCGGTACCGGTTCCAGAGCAATCACATGGATATGGTGAGAATAGAATCACCAGAGGAA
ATTTCTTTACTTCCCAAAACATCCTGGAATATCCCTCAGCCTGGTGAGGGTGATGTTCGG
GAGGAGGCCTTGTCCACAGGGGGACTTGATCTCATCTTCATGCCAGGCCTTGGGTTTGAC
AAACATGGCAACCGACTGGGGAGGGGCAAGGGCTACTATGATGCCTATCTGAAGCGCTGT
TTGCAGCATCAGGAAGTGAAGCCCTACACCCTGGCGTTGGCTTTCAAAGAACAGATTTGC
CTCCAGGTCCCAGTGAATGAAAACGACATGAAGGTAGATGAAGTCCTTTACGAAGACTCG
TCAACAGCTTAA
Protein Properties
Number of Residues 203
Molecular Weight 16813.995
Theoretical pI 4.993
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>5-formyltetrahydrofolate cyclo-ligase
MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQD
EIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVR
EEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQIC
LQVPVNENDMKVDEVLYEDSSTA
GenBank ID Protein 18044285
UniProtKB/Swiss-Prot ID P49914
UniProtKB/Swiss-Prot Entry Name MTHFS_HUMAN
PDB IDs
GenBank Gene ID BC019921
GeneCard ID MTHFS
GenAtlas ID MTHFS
HGNC ID HGNC:7437
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  3. Dayan A, Bertrand R, Beauchemin M, Chahla D, Mamo A, Filion M, Skup D, Massie B, Jolivet J: Cloning and characterization of the human 5,10-methenyltetrahydrofolate synthetase-encoding cDNA. Gene. 1995 Nov 20;165(2):307-11. [PubMed:8522195 ]
  4. Bertrand R, MacKenzie RE, Jolivet J: Human liver methenyltetrahydrofolate synthetase: improved purification and increased affinity for folate polyglutamate substrates. Biochim Biophys Acta. 1987 Jan 30;911(2):154-61. [PubMed:3801490 ]
  5. Wu D, Li Y, Song G, Cheng C, Zhang R, Joachimiak A, Shaw N, Liu ZJ: Structural basis for the inhibition of human 5,10-methenyltetrahydrofolate synthetase by N10-substituted folate analogues. Cancer Res. 2009 Sep 15;69(18):7294-301. doi: 10.1158/0008-5472.CAN-09-1927. Epub 2009 Sep 8. [PubMed:19738041 ]