You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01414
Secondary Accession Numbers
  • 6710
Name Serine/threonine-protein kinase RIO1
Synonyms
  1. RIO kinase 1
Gene Name RIOK1
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function ATP + a protein = ADP + a phosphoprotein
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:6
Locus 6p24.3
SNPs RIOK1
Gene Sequence
>1707 bp
ATGGACTACCGGCGGCTTCTCATGAGCCGGGTGGTCCCCGGGCAATTCGACGACGCGGAC
TCCTCTGACAGTGAAAACAGAGACTTGAAGACAGTCAAAGAGAAGGATGACATTCTGTTT
GAAGACCTTCAAGACAATGTGAATGAGAATGGTGAAGGTGAAATAGAAGATGAGGAGGAG
GAGGGTTATGACGATGATGATGATGACTGGGACTGGGATGAAGGAGTTGGAAAACTCGCC
AAGGGTTATGTCTGGAATGGAGGAAGCAACCCACAGGCAAATCGACAGACCTCCGACAGC
AGTTCAGCCAAAATGTCTACTCCAGCAGACAAGGTCTTACGGAAATTTGAGAATAAAATT
AATTTAGATAAGCTAAATGTTACTGATTCCGTCATAAATAAAGTCACCGAAAAGTCTAGA
CAAAAGGAAGCAGATATGTATCGCATCAAAGATAAGGCAGACAGAGCAACTGTAGAACAG
GTGTTGGATCCCAGAACAAGAATGATTTTATTCAAGATGTTGACTAGAGGAATCATAACA
GAGATAAATGGCTGCATTAGCACAGGAAAAGAAGCTAATGTATACCATGCTAGCACAGCA
AATGGAGAGAGCAGAGCAATCAAAATTTATAAAACTTCTATTTTGGTGTTCAAAGATCGG
GATAAATATGTAAGTGGAGAATTCAGATTTCGTCATGGCTATTGTAAAGGAAACCCTAGG
AAAATGGTGAAAACTTGGGCAGAAAAAGAAATGAGGAACTTAATCAGGCTAAACACAGCA
GAGATACCATGTCCAGAACCAATAATGCTAAGAAGTCATGTTCTTGTCATGAGTTTCATC
GGTAAAGATGACATGCCTGCACCACTCTTGAAAAATGTCCAGTTATCAGAATCCAAGGCT
CGGGAGTTGTACCTGCAGGTCATTCAGTACATGAGAAGAATGTATCAGGATGCCAGACTT
GTCCATGCAGATCTCAGTGAATTTAACATGCTGTACCACGGTGGAGGCGTGTATATCATT
GACGTGTCTCAGTCCGTGGAGCACGACCACCCACATGCCTTGGAGTTCTTGAGAAAGGAT
TGCGCCAACGTCAATGATTTCTTTATGAGGCACAGTGTTGCTGTCATGACTGTGCGGGAG
CTCTTTGAATTTGTCACAGATCCATCCATTACACATGAGAACATGGATGCTTATCTCTCA
AAGGCCATGGAAATAGCATCTCAAAGGACCAAGGAAGAACGGTCTAGCCAAGATCATGTG
GATGAAGAGGTGTTTAAGCGAGCATATATTCCTAGAACCTTGAATGAAGTGAAAAATTAT
GAGAGGGATATGGACATAATTATGAAATTGAAGGAAGAGGACATGGCCATGAATGCCCAA
CAAGATAATATTCTATACCAGACTGTTACAGGATTGAAGAAAGATTTGTCAGGAGTTCAG
AAGGTCCCTGCACTCCTAGAAAATCAAGTGGAGGAAAGGACTTGTTCTGATTCAGAAGAT
ATTGGAAGCTCTGAGTGCTCTGACACAGACTCTGAAGAGCAGGGAGACCATGCCCGCCCC
AAGAAACACACCACGGACCCTGACATTGATAAAAAAGAAAGAAAAAAGATGGTCAAGGAA
GCCCAGAGAGAGAAAAGAAAAAACAAAATTCCTAAACATGTGAAAAAAAGAAAGGAGAAG
ACAGCCAAGACGAAAAAAGGCAAATAG
Protein Properties
Number of Residues 568
Molecular Weight 65582.5
Theoretical pI 6.08
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Serine/threonine-protein kinase RIO1
MDYRRLLMSRVVPGQFDDADSSDSENRDLKTVKEKDDILFEDLQDNVNENGEGEIEDEEE
EGYDDDDDDWDWDEGVGKLAKGYVWNGGSNPQANRQTSDSSSAKMSTPADKVLRKFENKI
NLDKLNVTDSVINKVTEKSRQKEADMYRIKDKADRATVEQVLDPRTRMILFKMLTRGIIT
EINGCISTGKEANVYHASTANGESRAIKIYKTSILVFKDRDKYVSGEFRFRHGYCKGNPR
KMVKTWAEKEMRNLIRLNTAEIPCPEPIMLRSHVLVMSFIGKDDMPAPLLKNVQLSESKA
RELYLQVIQYMRRMYQDARLVHADLSEFNMLYHGGGVYIIDVSQSVEHDHPHALEFLRKD
CANVNDFFMRHSVAVMTVRELFEFVTDPSITHENMDAYLSKAMEIASQRTKEERSSQDHV
DEEVFKRAYIPRTLNEVKNYERDMDIIMKLKEEDMAMNAQQDNILYQTVTGLKKDLSGVQ
KVPALLENQVEERTCSDSEDIGSSECSDTDSEEQGDHARPKKHTTDPDIDKKERKKMVKE
AQREKRKNKIPKHVKKRKEKTAKTKKGK
GenBank ID Protein 23510356
UniProtKB/Swiss-Prot ID Q9BRS2
UniProtKB/Swiss-Prot Entry Name RIOK1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_031480.2
GeneCard ID RIOK1
GenAtlas ID RIOK1
HGNC ID HGNC:18656
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  6. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]