You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01424
Secondary Accession Numbers
  • 6720
Name Vesicle-fusing ATPase
Synonyms
  1. N-ethylmaleimide-sensitive fusion protein
  2. NEM-sensitive fusion protein
  3. Vesicular-fusion protein NSF
Gene Name NSF
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function Required for vesicle-mediated transport. Catalyzes the fusion of transport vesicles within the Golgi cisternae. Is also required for transport from the endoplasmic reticulum to the Golgi stack. Seem to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin. Interaction with AMPAR subunit GRIA2 leads to influence GRIA2 membrane cycling (By similarity).
Pathways
  • GABAergic synapse
  • Synaptic vesicle cycle
  • Vasopressin-regulated water reabsorption
Reactions
Adenosine triphosphate + Water → ADP + Phosphoric acid details
GO Classification
Biological Process
protein transport
exocytosis
plasma membrane fusion
positive regulation of receptor recycling
potassium ion transport
regulation of exocytosis
synaptic transmission
Cellular Component
cytosol
plasma membrane
Golgi stack
dendritic shaft
Function
endopeptidase activity
serine-type endopeptidase activity
binding
nucleotide binding
catalytic activity
hydrolase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
atpase activity
atpase activity, coupled
atp-dependent peptidase activity
nucleoside-triphosphatase activity
peptidase activity
peptidase activity, acting on l-amino acid peptides
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Molecular Function
metal ion binding
ATP binding
protein complex binding
ATPase activity, coupled
Process
metabolic process
macromolecule metabolic process
protein metabolic process
proteolysis
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 17
Locus 17q21
SNPs NSF
Gene Sequence
>2235 bp
ATGGCGGGCCGGAGCATGCAAGCGGCAAGATGTCCTACAGATGAATTATCTTTAACCAAT
TGTGCAGTTGTGAATGAAAAGGATTTCCAGTCTGGCCAGCATGTGATTGTGAGGACCTCT
CCCAATCACAGGTACACATTTACACTGAAGACACATCCATCGGTGGTTCCAGGGAGCATT
GCATTCAGTTTACCTCAGAGAAAATGGGCTGGGCTTTCTATTGGGCAAGAAATAGAAGTC
TCCTTATATACATTTGACAAAGCCAAACAGTGTATTGGCACAATGACCATCGAGATTGAT
TTCCTGCAGAAAAAAAGCATTGACTCCAACCCTTATGACACCGACAAGATGGCAGCAGAA
TTTATTCAGCAATTCAACAACCAGGCCTTCTCAGTGGGACAACAGCTTGTCTTTAGCTTC
AATGAAAAGCTTTTTGGCTTACTGGTGAAGGACATTGAAGCCATGGATCCTAGCATCCTG
AAGGGAGAGCCTGCGACAGGGAAAAGGCAGAAGATTGAAGTAGGACTGGTTGTTGGAAAC
AGTCAAGTTGCATTTGAAAAAGCAGAAAATTCGTCACTTAATCTTATTGGCAAAGCTAAA
ACCAAGGAAAATCGCCAATCAATTATCAATCCTGACTGGAACTTTGAAAAAATGGGAATA
GGAGGTCTAGACAAGGAATTTTCAGATATTTTCCGACGAGCATTTGCTTCCCGAGTATTT
CCTCCAGAGATTGTGGAGCAGATGGGTTGTAAACATGTTAAAGGCATCCTGTTATATGGA
CCCCCAGGTTGTGGTAAGACTCTCTTGGCTCGACAGATTGGCAAGATGTTGAATGCAAGA
GAGCCCAAAGTGGTCAATGGGCCAGAAATCCTTAACAAATATGTGGGAGAATCAGAGGCT
AACATTCGCAAACTTTTTGCTGATGCTGAAGAGGAGCAAAGGAGGCTTGGTGCTAACAGT
GGTTTGCACATCATCATCTTTGATGAAATTGATGCCATCTGCAAGCAGAGAGGGAGCATG
GCTGGTAGCACGGGAGTTCATGACACTGTTGTCAACCAGTTGCTGTCCAAAATTGATGGC
GTGGAGCAGCTAAACAACATCCTAGTCATTGGAATGACCAATAGACCAGATCTGATAGAT
GAGGCTCTTCTTAGACCTGGAAGACTGGAAGTTAAAATGGAGATAGGCTTGCCAGATGAG
AAAGGCCGACTACAGATTCTTCACATCCACACAGCAAGAATGAGAGGGCATCAGTTACTC
TCTGCTGATGTAGACATTAAAGAACTGGCCGTGGAGACCAAGAATTTCAGTGGTGCTGAA
TTGGAGGGTCTGGTGCGAGCAGCCCAGTCCACTGCTATGAATAGACACATAAAGGCCAGT
ACTAAAGTGGAAGTGGACATGGAGAAAGCAGAAAGCCTGCAAGTGACGAGAGGAGACTTC
CTTGCTTCTTTGGAGAATGATATCAAACCAGCCTTTGGCACAAACCAAGAAGATTATGCA
AGTTACATTATGAACGGTATCATCAAATGGGGTGACCCAGTTACTCGAGTTCTAGATGAT
GGGGAGCTGCTGGTGCAGCAGACTAAGAACAGTGACCGCACACCATTGGTCAGCGTGCTT
CTGGAAGGCCCTCCTCACAGTGGGAAGACTGCTTTAGCTGCAAAAATTGCAGAGGAATCC
AACTTCCCGTTCATCAAGATCTGTTCTCCTGATAAAATGATTGGCTTTTCTGAAACAGCC
AAATGTCAGGCCATGAAGAAGATCTTTGATGATGCGTACAAATCCCAGCTCAGTTGTGTG
GTTGTGGATGACATTGAGAGATTGCTTGATTACGTCCCTATTGGCCCTCGATTTTCAAAT
CTTGTATTACAGGCTCTTCTCGTTTTACTGAAAAAGGCACCTCCTCAGGGCCGCAAGCTT
CTTATCATTGGGACCACTAGCCGCAAAGATGTCCTTCAGGAGATGGAAATGCTTAACGCT
TTCAGCACCACCATCCACGTGCCCAACATTGCCACAGGAGAGCAGCTGTTGGAAGCTTTG
GAGCTTTTGGGCAACTTCAAGGATAAGGAACGCACCACAATTGCACAGCAAGTCAAAGGG
AAGAAGGTCTGGATAGGAATCAAGAAGTTACTAATGCTGATCGAGATGTCCCTACAGATG
GATCCTGAATACCGTGTGAGAAAATTCTTGGCCCTCTTAAGAGAAGAAGGAGCTAGCCCC
CTTGATTTTGATTGA
Protein Properties
Number of Residues 744
Molecular Weight 82593.645
Theoretical pI 6.953
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Vesicle-fusing ATPase
MAGRSMQAARCPTDELSLTNCAVVNEKDFQSGQHVIVRTSPNHRYTFTLKTHPSVVPGSI
AFSLPQRKWAGLSIGQEIEVSLYTFDKAKQCIGTMTIEIDFLQKKSIDSNPYDTDKMAAE
FIQQFNNQAFSVGQQLVFSFNEKLFGLLVKDIEAMDPSILKGEPATGKRQKIEVGLVVGN
SQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVF
PPEIVEQMGCKHVKGILLYGPPGCGKTLLARQIGKMLNAREPKVVNGPEILNKYVGESEA
NIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKIDG
VEQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDEKGRLQILHIHTARMRGHQLL
SADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTRGDF
LASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVL
LEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCV
VVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNA
FSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQM
DPEYRVRKFLALLREEGASPLDFD
GenBank ID Protein 156564401
UniProtKB/Swiss-Prot ID P46459
UniProtKB/Swiss-Prot Entry Name NSF_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_006178.2
GeneCard ID NSF
GenAtlas ID NSF
HGNC ID HGNC:8016
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196 ]