You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01434
Secondary Accession Numbers
  • 6730
Name Serine/threonine-protein kinase PLK2
Synonyms
  1. PLK-2
  2. Polo-like kinase 2
  3. Serine/threonine-protein kinase SNK
  4. Serum-inducible kinase
Gene Name PLK2
Protein Type Enzyme
Biological Properties
General Function Involved in protein binding
Specific Function May play a role in the division of at least some cell types, such as fibroblasts, and could function in embryogenesis, wound healing or neoplasia
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein binding
polo kinase kinase activity
protein kinase activity
protein serine/threonine kinase activity
receptor signaling protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:5
Locus 5q12.1-q13.2
SNPs PLK2
Gene Sequence
>2058 bp
ATGGARCTTTTGCGGACTATCACCTACCAGCCAGCCGCCAGCACCAAAATGTGCGAGCAG
GCGCTGGGCAAGGGTTGCGGAGGGGACTCGAAGAAGAAGCGGCCGCCGCAGCCCCCCGAG
GAATCGCAGCCACCTCAGTCCCAGGCGCAAGTGCCCCCGGCGGCCCCTCACCACCATCAC
CACCATTCGCACTCGGGGCCGGAGATCTCGCGGATTATCGTCGACCCCACGACTGGGAAG
CGCTACTGCCGGGGCAAAGTGCTGGGAAAGGGTGGCTTTGCAAAATGTTACGAGATGACA
GATTTGACAAATAACAAAGTCTACGCCGCAAAAATTATTCCTCACAGCAGAGTAGCTAAA
CCTCATCAAAGGGAAAAGATTGACAAAGAAATAGAGCTTCACAGAATTCTTCATCATAAG
CATGTAGTGCAGTTTTACCACTACTTCGAGGACAAAGAAAACATTTACATTCTCTTGGAA
TACTGCAGTAGAAGGTCAATGGCTCATATTTTGAAAGCAAGAAAGGTGTTGACAGAGCCA
GAAGTTCGATACTACCTCAGGCAGATTGTGTCTGGACTGAAATACCTTCATGAACAAGAA
ATCTTGCACAGAGATCTCAAACTAGGGAACTTTTTTATTAATGAAGCCATGGAACTAAAA
GTTGGGGACTTCGGTCTGGCAGCCAGGCTAGAACCCYTGGAACACAGAAGGAGAACGATA
TGTGGTACCCCAAATTATCTCTCTCCTGAAGTCCTCAACAAACAAGGACATGGCTGTGAA
TCAGACATTTGGGCCCTGGGCTGTGTAATGTATACAATGTTACTAGGGAGGCCCCCATTT
GAAACTACAAATCTCAAAGAAACTTATAGGTGCATAAGGGAAGCAAGGTATACAATGCCG
TCCTCATTGCTGGCTCCTGCCAAGCACTTAATTGCTAGTATGTTGTCCAAAAACCCAGAG
GATCGTCCCAGTTTGGATGACATCATTCGACATGACTTTTTTTTGCAGGGCTTCACTCCG
GACAGACTGTCTTCTAGCTGTTGTCATACAGTTCCAGATTTCCACTTATCAAGCCCAGCT
AAGAATTTCTTTAAGAAAGCAGCTGCTGCTCTTTTTGGTGGCAAAAAAGACAAAGCAAGA
TATATTGACACACATAATAGAGTGTCTAAAGAAGATGAAGACATCTACAAGCTTAGGCAT
GATTTGAAAAAGACTTCAATAACTCAGCAACCCAGCAAACACAGGACAGATGAGGAGCTC
CAGCCACCTACCACCACAGTTGCCAGGTCTGGAACACCCGCAGTAGAAAACAAGCAGCAG
ATTGGGGATGCTATTCGGATGATAGTCAGAGGGACTCTTGGCAGCTGTAGCAGCAGCAGT
GAATGCCTTGAAGACAGTACCATGGGAAGTGTTGCAGACACAGTGGCAAGGGTTCTTCGG
GGATGTCTGGAAAACATGCCGGAAGCTGATTGCATTCCCAAAGAGCAGCTGAGCACATCA
TTTCAGTGGGTCACCAAATGGGTTGATTACTCTAACAAATATGGCTTTGGGTACCAGCTC
TCAGACCACACCGTCGGTGTCCTTTTCAACAATGGTGCTCACATGAGCCTCCTTCCAGAC
AAAAAAACAGTTCACTATTACGCAGAGCTTGGCCAATGCTCAGTTTTCCCAGCAACAGAT
GCTCCTGAGCAATTTATTAGTCAAGTGACGGTGCTGAAATACTTTTCTCATTACATGGAG
GAGAACCTCATGGATGGTGGAGATCTGCCTAGTGTTACTGATATTCGAAGACCTCGGCTC
TACCTCCTTCAGTGGCTAAAATCTGATAAGGCCCTAATGATGCTCTTTAATGATGGCACC
TTTCAGGTGAATTTCTACCATGATCATACAAAAATCATCATCTGTAGCCAAAATGAAGAA
TACCTTCTCACCTACATCAATGAGGATAGGATATCTACAACTTTCAGGCTGACAACTCTG
CTGATGTCTGGCTGTTCATCAGAATTAAAAAATCGAATGGAATATGCCCTGAACATGCTC
TTACAAAGATGTAACTGA
Protein Properties
Number of Residues 685
Molecular Weight 78235.9
Theoretical pI 8.32
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Serine/threonine-protein kinase PLK2
MELLRTITYQPAASTKMCEQALGKGCGADSKKKRPPQPPEESQPPQSQAQVPPAAPHHHH
HHSHSGPEISRIIVDPTTGKRYCRGKVLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAK
PHQREKIDKEIELHRILHHKHVVQFYHYFEDKENIYILLEYCSRRSMAHILKARKVLTEP
EVRYYLRQIVSGLKYLHEQEILHRDLKLGNFFINEAMELKVGDFGLAARLEPLEHRRRTI
CGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYTMP
SSLLAPAKHLIASMLSKNPEDRPSLDDIIRHDFFLQGFTPDRLSSSCCHTVPDFHLSSPA
KNFFKKAAAALFGGKKDKARYIDTHNRVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEEL
QPPTTTVARSGTPAVENKQQIGDAIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLR
GCLENMPEADCIPKEQLSTSFQWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLLPD
KKTVHYYAELGQCSVFPATDAPEQFISQVTVLKYFSHYMEENLMDGGDLPSVTDIRRPRL
YLLQWLKSDKALMMLFNDGTFQVNFYHDHTKIIICSQNEEYLLTYINEDRISTTFRLTTL
LMSGCSSELKNRMEYALNMLLQRCN
GenBank ID Protein 3075509
UniProtKB/Swiss-Prot ID Q9NYY3
UniProtKB/Swiss-Prot Entry Name PLK2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF059617
GeneCard ID PLK2
GenAtlas ID PLK2
HGNC ID HGNC:19699
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]