You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01457
Secondary Accession Numbers
  • 6753
Name Serine/threonine-protein kinase PAK 2
Synonyms
  1. C-t-PAK2
  2. Gamma-PAK
  3. PAK-2
  4. PAK-2p27
  5. PAK-2p34
  6. PAK65
  7. S6/H4 kinase
  8. p21-activated kinase 2
  9. p27
  10. p34
  11. p58
Gene Name PAK2
Protein Type Unknown
Biological Properties
General Function Involved in protein kinase activity
Specific Function The activated kinase acts on a variety of targets. Phosphorylates ribosomal protein S6, histone H4 and myelin basic protein. Full length PAK 2 stimulates cell survival and cell growth. The process is, at least in part, mediated by phosphorylation and inhibition of pro-apoptotic BAD. Caspase- activated PAK-2p34 is involved in cell death response, probably involving the JNK signaling pathway. Cleaved PAK-2p34 seems to have a higher activity than the CDC42-activated form
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Lipid-anchor
  2. Cytoplasm
  3. perinuclear region
  4. Membrane
  5. PAK-2p34:Nucleus
Gene Properties
Chromosome Location Chromosome:3
Locus 3q29
SNPs PAK2
Gene Sequence
>1575 bp
ATGTCTGATAACGGAGAACTGGAAGATAAGCCTCCAGCACCTCCTGTGCGAATGAGCAGC
ACCATCTTTAGCACTGGAGGCAAAGACCCTTTGTCAGCCAATCACAGTTTGAAACCTTTG
CCCTCTGTTCCAGAAGAGAAAAAGCCCAGGCATAAAATCATCTCCATATTCTCAGGCACA
GAGAAAGGAAGTAAAAAGAAGGAAAAGGAACGGCCAGAAATTTCTCCTCCATCTGATTTT
GAGCACACCATCCATGTTGGTTTTGATGCTGTTACTGGAGAATTCACTGGCATGCCAGAA
CAGTGGGCTCGATTACTACAGACCTCCAATATCACCAAACTAGAGCAAAAGAAGAACCCT
CAGGCTGTGCTGGATGTCCTAAAGTTCTACGACTCCAACACAGTGAAGCAGAAATATCTG
AGCTTTACTCCTCCTGAGAAAGATGGCTTTCCTTCTGGAACACCAGCACTGAATGCCAAG
GGAACAGAAGCACCCGCAGTAGTGACAGAGGAGGAGGATGATGATGAAGAGACTGCTCCT
CCCGTTATTGCCCCGCGACCGGATCATACGAAATCAATTTACACACGGTCTGTAATTGAC
CCTGTTCCTGCACCAGTTGGTGATTCACATGTTGATGGTGCTGCCAAGTCTTTAGACAAA
CAGAAAAAGAAGACTAAGATGACAGATGAAGAGATTATGGAGAAATTAAGAACTATCGTG
AGCATAGGTGACCCTAAGAAAAAATATACAAGATATGAAAAAATTGGACAAAGGGCTTCT
GGTACAGTTTTCACTGCTACTGACGTTGCACTGGGACAGGAGGTTGCTATCAAACAAATT
AATTTACAGAAACAGCCAAAGAAGGAACTGATCATTAACGAGATTCTGGTGATGAAAGAA
TTGAAAAATCCCAACATCGTTAACTTTTTGGACAGTTACCTGGTAGGAGATGAATTGTTT
GTGGTCATGGAATACCTTGCTGGGGGGTCACTCACTGATGTGGTAACAGAAACGTGCATG
GATGAAGCACAGATTGCTGCTGTATGCAGAGAGTGTTTACAGGCATTGGAGTTTTTACAT
GCTAATCAAGTGATCCACAGAGACATCAAAAGTGACAATGTACTTTTGGGAATGGAAGGA
TCTGTTAAGCTCACTGACTTTGGTTTCTGTGCCCAGATCACCCCTGAGCAGAGCAAACGC
AGTACCATGGTCGGAACGCCATACTGGATGGCACCAGAGGTGGTTACACGGAAAGCTTAT
GGCCCTAAAGTCGACATATGGTCTCTGGGTATCATGGCTATTGAGATGGTAGAAGGAGAG
CCTCCATACCTCAATGAAAATCCCTTGAGGGCCTTGTACCTAATAGCAACTAATGGAACC
CCAGAACTTCAGAATCCAGAGAAACTTTCCCCAATATTTCGGGATTTCTTAAATCGATGT
TTGGAAATGGATGTGGAAAAAAGGGGTTCAGCCAAAGAATTATTACAGCATCCTTTCCTG
AAACTGGCCAAACCGTTATCTAGCTTGACACCACTGATCATGGCAGCTAAAGAAGCAATG
AAGAGTAACCGTTAA
Protein Properties
Number of Residues 524
Molecular Weight 58042.1
Theoretical pI 5.76
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Serine/threonine-protein kinase PAK 2
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGT
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAP
PVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRC
LEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
GenBank ID Protein 47482156
UniProtKB/Swiss-Prot ID Q13177
UniProtKB/Swiss-Prot Entry Name PAK2_HUMAN
PDB IDs
GenBank Gene ID BC069613
GeneCard ID PAK2
GenAtlas ID PAK2
HGNC ID HGNC:8591
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  6. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  7. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  8. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  9. Martin GA, Bollag G, McCormick F, Abo A: A novel serine kinase activated by rac1/CDC42Hs-dependent autophosphorylation is related to PAK65 and STE20. EMBO J. 1995 May 1;14(9):1970-8. [PubMed:7744004 ]
  10. Martin GA, Bollag G, McCormick F, Abo A: A novel serine kinase activated by rac1/CDC42Hs-dependent autophosphorylation is related to PAK65 and STE20. EMBO J. 1995 Sep 1;14(17):4385. [PubMed:7556080 ]
  11. Benner GE, Dennis PB, Masaracchia RA: Activation of an S6/H4 kinase (PAK 65) from human placenta by intramolecular and intermolecular autophosphorylation. J Biol Chem. 1995 Sep 8;270(36):21121-8. [PubMed:7673144 ]
  12. Rudel T, Bokoch GM: Membrane and morphological changes in apoptotic cells regulated by caspase-mediated activation of PAK2. Science. 1997 Jun 6;276(5318):1571-4. [PubMed:9171063 ]
  13. Walter BN, Huang Z, Jakobi R, Tuazon PT, Alnemri ES, Litwack G, Traugh JA: Cleavage and activation of p21-activated protein kinase gamma-PAK by CPP32 (caspase 3). Effects of autophosphorylation on activity. J Biol Chem. 1998 Oct 30;273(44):28733-9. [PubMed:9786869 ]
  14. Arora VK, Molina RP, Foster JL, Blakemore JL, Chernoff J, Fredericksen BL, Garcia JV: Lentivirus Nef specifically activates Pak2. J Virol. 2000 Dec;74(23):11081-7. [PubMed:11070003 ]
  15. Jakobi R, McCarthy CC, Koeppel MA, Stringer DK: Caspase-activated PAK-2 is regulated by subcellular targeting and proteasomal degradation. J Biol Chem. 2003 Oct 3;278(40):38675-85. Epub 2003 Jul 9. [PubMed:12853446 ]
  16. Koeppel MA, McCarthy CC, Moertl E, Jakobi R: Identification and characterization of PS-GAP as a novel regulator of caspase-activated PAK-2. J Biol Chem. 2004 Dec 17;279(51):53653-64. Epub 2004 Oct 7. [PubMed:15471851 ]
  17. Karkkainen S, Hiipakka M, Wang JH, Kleino I, Vaha-Jaakkola M, Renkema GH, Liss M, Wagner R, Saksela K: Identification of preferred protein interactions by phage-display of the human Src homology-3 proteome. EMBO Rep. 2006 Feb;7(2):186-91. [PubMed:16374509 ]
  18. Vilas GL, Corvi MM, Plummer GJ, Seime AM, Lambkin GR, Berthiaume LG: Posttranslational myristoylation of caspase-activated p21-activated protein kinase 2 (PAK2) potentiates late apoptotic events. Proc Natl Acad Sci U S A. 2006 Apr 25;103(17):6542-7. Epub 2006 Apr 14. [PubMed:16617111 ]
  19. Nola S, Sebbagh M, Marchetto S, Osmani N, Nourry C, Audebert S, Navarro C, Rachel R, Montcouquiol M, Sans N, Etienne-Manneville S, Borg JP, Santoni MJ: Scrib regulates PAK activity during the cell migration process. Hum Mol Genet. 2008 Nov 15;17(22):3552-65. doi: 10.1093/hmg/ddn248. Epub 2008 Aug 20. [PubMed:18716323 ]