You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01478
Secondary Accession Numbers
  • 6774
Name Tyrosine-protein kinase FRK
Synonyms
  1. FYN-related kinase
  2. Nuclear tyrosine protein kinase RAK
  3. Protein-tyrosine kinase 5
Gene Name FRK
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase activity
Specific Function Positively regulates PTEN protein stability through phosphorylation of PTEN on 'Tyr-336', which in turn prevents its ubiquitination and degradation possibly by reducing its binding to NEDD4. May function as a tumor suppressor
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
protein tyrosine kinase activity
non-membrane spanning protein tyrosine kinase activity
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein binding
protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Cytoplasm (Probable)
Gene Properties
Chromosome Location Chromosome:6
Locus 6q21-q22.3
SNPs FRK
Gene Sequence
>1518 bp
ATGAGCAACATCTGTCAGAGGCTCTGGGAGTACCTAGAACCCTATCTCCCCTGTTTGTCC
ACGGAGGCAGACAAGTCAACCGTGATTGAAAATCCAGGGGCCCTTTGCTCTCCCCAGTCA
CAGAGGCATGGCCACTACTTTGTGGCTTTGTTTGATTACCAGGCTCGGACTGCTGAGGAC
TTGAGCTTCCGAGCAGGTGACAAACTTCAAGTTCTGGACACTTTGCATGAGGGCTGGTGG
TTTGCCAGACACTTGGAGAAAAGACGAGATGGCTCCAGTCAGCAACTACAAGGCTATATT
CCTTCTAACTACGTGGCTGAGGACAGAAGCCTACAGGCAGAGCCGTGGTTCTTTGGAGCA
ATCGGAAGATCAGATGCAGAGAAACAACTATTATATTCAGAAAACAAGACCGGTTCCTTT
CTAATCAGAGAAAGTGAAAGCCAAAAAGGAGAATTCTCTCTTTCAGTTTTAGATGGAGCA
GTTGTAAAACACTACAGAATTAAAAGACTGGATGAAGGGGGATTTTTTCTCACGCGAAGA
AGAATCTTTTCAACACTGAACGAATTTGTGAGCCACTACACCAAGACAAGTGACGGCCTG
TGTGTCAAGCTGGGGAAACCATGCTTAAAGATCCAGGTCCCAGCTCCATTTGATTTGTCG
TATAAAACCGTGGACCAATGGGAGATAGACCGCAACTCCATACAGCTTCTGAAGCGATTG
GGATCTGGTCAGTTTGGCGAAGTATGGGAAGGTCTGTGGAACAATACCACTCCAGTAGCA
GTGAAAACATTAAAACCAGGTTCAATGGATCCAAATGACTTCCTGAGGGAGGCACAGATA
ATGAAGAACCTAAGACATCCAAAGCTTATCCAGCTTTATGCTGTTTGCACTTTAGAAGAT
CCAATTTATATTATTACAGAGTTGATGAGACATGGAAGTCTGCAAGAATATCTCCAAAAT
GACACTGGATCAAAAATCCATCTGACTCAACAGGTAGACATGGCGGCACAGGTTGCCTCT
GGAATGGCCTATCTGGAGTCTCGGAACTACATTCACAGAGATCTGGCTGCCAGAAATGTC
CTCGTTGGTGAACATAATATCTACAAAGTAGCAGATTTTGGACTTGCCAGAGTTTTTAAG
GTAGATAATGAAGACATCTATGAATCTAGACACGAAATAAAGCTGCCGGTGAAGTGGACT
GCGCCCGAAGCCATTCGTAGTAATAAATTCAGCATTAAGTCCGATGTATGGTCATTTGGA
ATCCTTCTTTATGAAATCATTACTTATGGCAAAATGCCTTACAGTGGTATGACAGGTGCC
CAGGTAATCCAGATGTTGGCTCAAAACTATAGACTTCCGCAACCATCCAACTGTCCACAG
CAATTTTACAACATCATGTTGGAGTGCTGGAATGCAGAGCCTAAGGAACGACCTACATTT
GAGACACTGCGTTGGAAACTTGAAGACTATTTTGAAACAGACTCTTCATATTCAGATGCA
AATAACTTCATAAGATGA
Protein Properties
Number of Residues 505
Molecular Weight 58253.6
Theoretical pI 6.65
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Tyrosine-protein kinase FRK
MSNICQRLWEYLEPYLPCLSTEADKSTVIENPGALCSPQSQRHGHYFVALFDYQARTAED
LSFRAGDKLQVLDTLHEGWWFARHLEKRRDGSSQQLQGYIPSNYVAEDRSLQAEPWFFGA
IGRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVLDGAVVKHYRIKRLDEGGFFLTRR
RIFSTLNEFVSHYTKTSDGLCVKLGKPCLKIQVPAPFDLSYKTVDQWEIDRNSIQLLKRL
GSGQFGEVWEGLWNNTTPVAVKTLKPGSMDPNDFLREAQIMKNLRHPKLIQLYAVCTLED
PIYIITELMRHGSLQEYLQNDTGSKIHLTQQVDMAAQVASGMAYLESRNYIHRDLAARNV
LVGEHNIYKVADFGLARVFKVDNEDIYESRHEIKLPVKWTAPEAIRSNKFSIKSDVWSFG
ILLYEIITYGKMPYSGMTGAQVIQMLAQNYRLPQPSNCPQQFYNIMLECWNAEPKERPTF
ETLRWKLEDYFETDSSYSDANNFIR
GenBank ID Protein 56203498
UniProtKB/Swiss-Prot ID P42685
UniProtKB/Swiss-Prot Entry Name FRK_HUMAN
PDB IDs Not Available
GenBank Gene ID AL121963
GeneCard ID FRK
GenAtlas ID FRK
HGNC ID HGNC:3955
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  5. Zhang Y, Wolf-Yadlin A, Ross PL, Pappin DJ, Rush J, Lauffenburger DA, White FM: Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules. Mol Cell Proteomics. 2005 Sep;4(9):1240-50. Epub 2005 Jun 11. [PubMed:15951569 ]
  6. Heibeck TH, Ding SJ, Opresko LK, Zhao R, Schepmoes AA, Yang F, Tolmachev AV, Monroe ME, Camp DG 2nd, Smith RD, Wiley HS, Qian WJ: An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells. J Proteome Res. 2009 Aug;8(8):3852-61. doi: 10.1021/pr900044c. [PubMed:19534553 ]
  7. Wolf-Yadlin A, Hautaniemi S, Lauffenburger DA, White FM: Multiple reaction monitoring for robust quantitative proteomic analysis of cellular signaling networks. Proc Natl Acad Sci U S A. 2007 Apr 3;104(14):5860-5. Epub 2007 Mar 26. [PubMed:17389395 ]
  8. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  9. Cance WG, Craven RJ, Bergman M, Xu L, Alitalo K, Liu ET: Rak, a novel nuclear tyrosine kinase expressed in epithelial cells. Cell Growth Differ. 1994 Dec;5(12):1347-55. [PubMed:7696183 ]
  10. Lee J, Wang Z, Luoh SM, Wood WI, Scadden DT: Cloning of FRK, a novel human intracellular SRC-like tyrosine kinase-encoding gene. Gene. 1994 Jan 28;138(1-2):247-51. [PubMed:7510261 ]
  11. Cance WG, Craven RJ, Weiner TM, Liu ET: Novel protein kinases expressed in human breast cancer. Int J Cancer. 1993 Jun 19;54(4):571-7. [PubMed:8099900 ]
  12. Yim EK, Peng G, Dai H, Hu R, Li K, Lu Y, Mills GB, Meric-Bernstam F, Hennessy BT, Craven RJ, Lin SY: Rak functions as a tumor suppressor by regulating PTEN protein stability and function. Cancer Cell. 2009 Apr 7;15(4):304-14. doi: 10.1016/j.ccr.2009.02.012. [PubMed:19345329 ]