You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01487
Secondary Accession Numbers
  • 6783
Name Tyrosine-protein kinase ITK/TSK
Synonyms
  1. Kinase EMT
  2. T-cell-specific kinase
  3. Tyrosine-protein kinase Lyk
Gene Name ITK
Protein Type Unknown
Biological Properties
General Function Involved in protein kinase activity
Specific Function Plays a role in T-cell proliferation and differentiation
Pathways Not Available
Reactions Not Available
GO Classification
Function
protein tyrosine kinase activity
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein binding
protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
intracellular signaling pathway
signaling
signaling pathway
phosphorylation
Cellular Location
  1. Cell membrane
Gene Properties
Chromosome Location Chromosome:5
Locus 5q31-q32
SNPs ITK
Gene Sequence
>1863 bp
ATGAACAACTTTATCCTCCTGGAAGAACAGCTCATCAAGAAATCCCAACAAAAGAGAAGA
ACTTCTCCCTCGAACTTTAAAGTCCGCTTCTTCGTGTTAACCAAAGCCAGCCTGGCATAC
TTTGAAGATCGTCATGGGAAGAAGCGCACGCTGAAGGGGTCCATTGAGCTCTCCCGAATC
AAATGTGTTGAGATTGTGAAAAGTGACATCAGCATCCCATGCCACTATAAATACCCGTTT
CAGGTGGTGCATGACAACTACCTCCTATATGTGTTTGCTCCAGATCGTGAGAGCCGGCAG
CGCTGGGTGCTGGCCCTTAAAGAAGAAACGAGGAATAATAACAGTTTGGTGCCTAAATAT
CATCCTAATTTCTGGATGGATGGGAAGTGGAGGTGCTGTTCTCAGCTGGAGAAGCTTGCA
ACAGGCTGTGCCCAATATGATCCAACCAAGAATGCTTCAAAGAAGCCTCTTCCTCCTACT
CCTGAAGACAACAGGCGACCACTTTGGGAACCTGAAGAAACTGTGGTCATTGCCTTATAT
GACTACCAAACCAATGATCCTCAGGAACTCGCACTGCGGCGCAACGAAGAGTACTGCCTG
CTGGACAGTTCTGAGATTCACTGGTGGAGAGTCCAGGACAGGAATGGGCATGAAGGATAT
GTACCAAGCAGTTATCTGGTGGAAAAATCTCCAAATAATCTGGAAACCTATGAGTGGTAC
AATAAGAGTATCAGCCGAGACAAAGCTGAAAAACTTCTTTTGGACACAGGCAAAGAAGGA
GCCTTCATGGTAAGGGATTCCAGGACTGCAGGAACATACACCGTGTCTGTTTTCACCAAG
GCTGTTGTAAGTGAGAACAATCCCTGTATAAAGCATTATCACATCAAGGAAACAAATGAC
AATCCTAAGCGATACTATGTGGCTGAAAAGTATGTGTTCGATTCCATCCCTCTTCTCATC
AACTATCACCAACATAATGGAGGAGGCCTGGTGACTCGACTCCGGTATCCAGTTTGTTTT
GGGAGGCAGAAAGCCCCAGTTACAGCAGGGCTGAGATACGGGAAATGGGTGATCGACCCC
TCAGAGCTCACTTTTGTGCAAGAGATTGGCAGTGGGCAATTTGGGTTGGTGCATCTGGGC
TACTGGCTCAACAAGGACAAGGTGGCTATCAAAACCATTCGGGAAGGGGCTATGTCAGAA
GAGGACTTCATAGAGGAGGCTGAAGTAATGATGAAACTCTCTCATCCCAAACTGGTGCAG
CTGTATGGGGTGTGCCTGGAGCAGGCCCCCATCTGCCTGGTGTTTGAGTTCATGGAGCAC
GGCTGCCTGTCAGATTATCTACGCACCCAGCGGGGACTTTTTGCTGCAGAGACCCTGCTG
GGCATGTGTCTGGATGTGTGTGAGGGCATGGCCTACCTGGAAGAGGCATGTGTCATCCAC
AGAGACTTGGCTGCCAGAAATTGTTTGGTGGGAGAAAACCAAGTCATCAAGGTGTCTGAC
TTTGGGATGACAAGGTTCGTTCTGGATGATCAGTACACCAGTTCCACAGGCACCAAATTC
CCGGTGAAGTGGGCATCCCCAGAGGTTTTCTCTTTCAGTCGCTATAGCAGCAAGTCCGAT
GTGTGGTCATTTGGTGTGCTGATGTGGGAAGTTTTCAGTGAAGGCAAAATCCCGTATGAA
AACCGAAGCAACTCAGAGGTGGTGGAAGACATCAGTACCGGATTTCGGTTGTACAAGCCC
CGGCTGGCCTCCACACACGTCTACCAGATTATGAATCACTGCTGGAAAGAGAGACCAGAA
GATCGGCCAGCCTTCTCCAGACTGCTGCGTCAACTGGCTGAAATTGCAGAATCAGGACTT
TAG
Protein Properties
Number of Residues 620
Molecular Weight 71830.4
Theoretical pI 7.63
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Tyrosine-protein kinase ITK/TSK
MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRI
KCVEIVKSDISIPCHYKYPFQVVHDNYLLYVFAPDRESRQRWVLALKEETRNNNSLVPKY
HPNFWMDGKWRCCSQLEKLATGCAQYDPTKNASKKPLPPTPEDNRRPLWEPEETVVIALY
DYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWY
NKSISRDKAEKLLLDTGKEGAFMVRDSRTAGTYTVSVFTKAVVSENNPCIKHYHIKETND
NPKRYYVAEKYVFDSIPLLINYHQHNGGGLVTRLRYPVCFGRQKAPVTAGLRYGKWVIDP
SELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQ
LYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIH
RDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSD
VWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPE
DRPAFSRLLRQLAEIAESGL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q08881
UniProtKB/Swiss-Prot Entry Name ITK_HUMAN
PDB IDs
GenBank Gene ID D13720
GeneCard ID ITK
GenAtlas ID ITK
HGNC ID HGNC:6171
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  6. Wissing J, Jansch L, Nimtz M, Dieterich G, Hornberger R, Keri G, Wehland J, Daub H: Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry. Mol Cell Proteomics. 2007 Mar;6(3):537-47. Epub 2006 Dec 27. [PubMed:17192257 ]
  7. Nore BF, Mattsson PT, Antonsson P, Backesjo CM, Westlund A, Lennartsson J, Hansson H, Low P, Ronnstrand L, Smith CI: Identification of phosphorylation sites within the SH3 domains of Tec family tyrosine kinases. Biochim Biophys Acta. 2003 Feb 21;1645(2):123-32. [PubMed:12573241 ]
  8. Tanaka N, Asao H, Ohtani K, Nakamura M, Sugamura K: A novel human tyrosine kinase gene inducible in T cells by interleukin 2. FEBS Lett. 1993 Jun 7;324(1):1-5. [PubMed:8504851 ]
  9. Gibson S, Leung B, Squire JA, Hill M, Arima N, Goss P, Hogg D, Mills GB: Identification, cloning, and characterization of a novel human T-cell-specific tyrosine kinase located at the hematopoietin complex on chromosome 5q. Blood. 1993 Sep 1;82(5):1561-72. [PubMed:8364206 ]
  10. Huck K, Feyen O, Niehues T, Ruschendorf F, Hubner N, Laws HJ, Telieps T, Knapp S, Wacker HH, Meindl A, Jumaa H, Borkhardt A: Girls homozygous for an IL-2-inducible T cell kinase mutation that leads to protein deficiency develop fatal EBV-associated lymphoproliferation. J Clin Invest. 2009 May;119(5):1350-8. [PubMed:19425169 ]