You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01489
Secondary Accession Numbers
  • 6785
Name Probable phospholipid-transporting ATPase IK
Synonyms
  1. ATPase class I type 8B member 3
Gene Name ATP8B3
Protein Type Unknown
Biological Properties
General Function Involved in ATP binding
Specific Function ATP + H(2)O + phospholipid(In) = ADP + phosphate + phospholipid(Out)
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
magnesium ion binding
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
substrate-specific transporter activity
lipid transporter activity
phospholipid transporter activity
phospholipid-translocating atpase activity
atpase activity, coupled to transmembrane movement of ions
atpase activity, coupled to transmembrane movement of ions, phosphorylative mechanism
hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
hydrolase activity, acting on acid anhydrides
Process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
purine nucleoside triphosphate biosynthetic process
purine ribonucleoside triphosphate biosynthetic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
establishment of localization
transport
lipid transport
phospholipid transport
atp biosynthetic process
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13.3
SNPs ATP8B3
Gene Sequence
>3903 bp
ATGGGCACTGGCCCCGCTCAGACTCCCAGGAGCACCAGAGCTGGCCCTGAGCCAAGCCCT
GCCCCACCAGGACCTGGGGACACGGGTGACTCAGACGTGACTCAGGAAGGCTCAGGTCCT
GCTGGCATCCGCGGAGGTGAGACGGTGATCAGAGCTGGGATGGGAGACTCCCCAGGCAGA
GGGGCACCTGAGAGGAGGCACAAGGCCCAGCCTGGCCGGGCTAGGAAGTATGAATGGAGA
CCAGAAGGCCCCACCAGCATGGGCAGCCTCGGCCAGAGAGAAGATCTCCAAGATGAGGAC
AGGAACTCAGCATTCACCTGGAAGGTCCAGGCCAACAACCGTGCCTACAACGGGCAGTTC
AAGGAGAAGGTGATCCTGTGCTGGCAAAGGAAGAAATACAAGACCAATGTCATCCGCACG
GCCAAGTACAACTTCTACTCGTTCCTGCCGCTGAACCTGTACGAGCAGTTCCACCGCGTG
TCCAACCTGTTCTTCCTCATCATCATCATCCTGCAGAGCATTCCCGACATCTCCACGCTG
CCCTGGTTCTCGCTCAGTACCCCTATGGTCTGCCTCCTCTTCATCCGTGCCACCCGGGAC
CTGGTGGACGACATGGGGAGACACAAGAGTGACAGAGCCATCAACAACAGACCCTGCCAG
ATTCTGATGGGGAAGAGCTTCAAGCAGAAGAAATGGCAGGATCTGTGCGTGGGGGATGTG
GTCTGTCTCCGCAAGGACAACATCGTCCCAGCCGACATGCTCTTGCTGGCCAGCACGGAG
CCCAGCAGCCTGTGCTATGTGGAGACGGTGGACATTGACGGGGAGACCAACTTGAAGTTC
AGACAGGCCCTGATGGTCACCCACAAAGAACTGGCCACTATAAAGAAGATGGCGTCCTTT
CAAGGCACAGTGACGTGTGAGGCGCCTAACAGTCGGATGCACCACTTCGTGGGGTGCCTG
GAATGGAATGACAAGAAATACTCCCTGGACATTGGCAACCTCCTCCTCCGAGGCTGCAGG
ATTCGCAACACAGACACCTGCTATGGACTGGTCATTTATGCTGGTTTTGACACAAAAATT
ATGAAGAACTGTGGCAAGATCCATTTGAAGAGAACCAAGCTGGACCTCCTGATGAACAAG
CTGGTGGTTGTGATCTTCATCTCCGTGGTGCTTGTCTGCCTGGTGTTGGCCTTCGGCTTC
GGTTTCTCAGTCAAAGAATTCAAAGACCACCACTACTACCTCTCGGGGGTGCATGGGAGC
AGCGTGGCCGCAGAGTCCTTCTTCGTCTTCTGGAGCTTCCTCATCCTGCTCAGCGTCACC
ATCCCGATGTCCATGTTCATCCTGTCCGAGTTCATCTACCTGGGGAACAGCGTCTTCATC
GACTGGGACGTGCAGATGTACTACAAGCCGCAGGACGTGCCTGCCAAGGCCCGCAGCACC
AGCCTCAACGACCACCTGGGCCAGGTGGAATACATCTTCTCGGACAAGACGGGCACGCTC
ACGCAGAACATCTTGACCTTCAACAAGTGCTGCATCAGCGGCCGCGTCTATGGGCCGGAT
TCAGAGGCCACGACCCGACCTAAGGAGAACCCCTACCTCTGGAACAAGTTCGCCGACGGG
AAGCTGCTCTTCCACAATGCGGCCCTGCTGCACCTCGTGCGGACCAACGGGGACGAGGCC
GTGCGGGAGTTCTGGCGCCTGCTGGCCATCTGCCACACGGTGATGGTGCGGGAGAGCCCC
CGTGAGCGCCCAGACCAGCTGTTGTACCAGGCGGCCTCCCCCGACGAGGGGGCGCTGGTC
ACCGCAGCCCGGAACTTCGGCTACGTGTTCCTGTCCCGCACCCAGGACACCGTCACGATC
ATGGAGCTGGGGGAGGAACGGGTCTACCAGGTCCTGGCCATAATGGACTTCAACAGCACG
CGCAAACGGATGTCGGTGCTGGTTCGAAAGCCAGAGGGCGCCATCTGCCTGTACACCAAG
GGCGCCGACACGGTCATCTTCGAACGCTTGCACAGGAGGGGGGCAATGGAATTTGCCACA
GAGGAGGCCTTGGCTGCCTTTGCCCAGGAGACCCTGCGGACACTGTGCCTGGCCTACAGG
GAGGTGGCTGAGGACATTTACGAGGACTGGCAGCAGCGCCACCAGGAGGCCAGCCTCCTG
CTGCAGAACCGGGCACAGGCCCTGCAACAGCTGCTGGGAGCCACAGCCATCGAGGACAGA
CTCCAGGACGGTGTCCCTGAAACCATCAAATGTCTCAAGAAGAGCAACATCAAAATATGG
GTGCTCACCGGGGACAAGCAGGAAACGGCTGTGAACATCGGCTTCGCCTGCGAGCTGCTG
TCAGAGAATATGCTCATTCTGGAGGAGAAGGAGATTAGCCGCATCCTGGAGACCTACTGG
GAAAACAGTAACAACCTTCTAACCAGGGAGTCCCTGTCGCAGGTCAAGCTGGCCTTGGTC
ATTAACGGAGACTTCCTGGACAAACTGCTGGTGTCCCTGCGGAAGGAGCCGCGCGCCCTG
GCGCAGAACGTGAACATGGACGAGGCGTGGCAGGAGCTCGGCCAGTCCAGGAGGGATTTC
CTCTACGCCAGGCGCCTGTCCCTGCTGTGCCGGAGGTTCGGGCTCCCGCTGGCTGCACCG
CCAGCCCAGGACTCCAGAGCCCGCCGTAGCTCCGAGGTGCTGCAGGAGCGCGCCTTCGTG
GACCTGGCGTCCAAGTGCCAGGCGGTCATCTGCTGCCGCGTGACGCCCAAGCAGAAGGCC
CTGATCGTGGCCCTGGTCAAGAAGTACCACCAGGTGGTGACCCTGGCCATCGGGGACGGT
GCCAACGACATCAACATGATCAAGACCGCGGACGTGGGCGTGGGGCTGGCGGGCCAGGAG
GGCATGCAGGCAGTTCAGAACAGCGACTTCGTGCTCGGCCAGTTCTGCTTCCTGCAGCGC
CTCCTGCTGGTGCACGGCCGCTGGTCCTACGTGCGGATCTGCAAGTTCCTGCGCTACTTC
TTCTACAAGAGCATGGCCAGCATGATGGTGCAGGTCTGGTTTGCCTGCTACAACGGCTTC
ACCGGCCAGCCCCTGTATGAAGGATGGTTCCTGGCTCTTTTCAACCTCCTGTACAGCACC
CTGCCAGTTCTCTACATTGGGCTCTTTGAGCAGGACGTGAGCGCAGAGCAGAGCCTGGAG
AAGCCGGAGCTGTACGTGGTGGGGCAGAAGGACGAGCTCTTCAACTACTGGGTCTTCGTC
CAAGCCATCGCCCATGGTGTGACCACCTCTCTGGTCAACTTCTTCATGACACTGTGGATC
AGCCGCGACACGGCGGGACCCGCCAGCTTCAGCGACCACCAGTCCTTTGCGGTCGTGGTG
GCCCTGTCTTGCCTGCTGTCCATCACCATGGAGGTCATTCTTATCATCAAGTACTGGACC
GCCCTGTGCGTGGCGACCATCCTCCTCAGCCTTGGTTTCTACGCCATCATGACTACCACC
ACCCAGAGCTTCTGGCTCTTCAGAGTATCCCCCACGACCTTCCCGTTTCTGTATGCCGAC
CTCAGCGTGATGTCCTCTCCCTCCATCCTGCTGGTGGTCCTGCTGAGTGTGTCCATAAAC
ACCTTCCCTGTCCTGGCCCTCCGAGTCATCTTCCCAGCCCTCAAGGAGCTACGTGCCAAG
GAGGAGAAGGTGGAGGAGGGCCCCAGCGAGGAGATTTTCACCATGGAGCCCTTGCCTCAT
GTACACCGGGAGTCTCGTGCCCGCCGTTCCAGCTATGCTTTCTCCCACCGTGAGGGATAT
GCAAACCTCATCACTCAGGGCACAATTCTGCGGAGGGGACCAGGGGTCAGCAGTGACATA
GCATCTGAATCCCTAGACCCATCTGATGAAGAGGCAGCTTCGAGCCCAAAAGAGTCACAG
TGA
Protein Properties
Number of Residues 1300
Molecular Weight 146750.9
Theoretical pI 7.96
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 150-171
  • 178-197
  • 382-403
  • 431-452
  • 996-1016
  • 1029-1048
  • 1079-1100
  • 1113-1135
  • 1142-1162
  • 1183-1207
Protein Sequence
>Probable phospholipid-transporting ATPase IK
MGTGPAQTPRSTRAGPEPSPAPPGPGDTGDSDVTQEGSGPAGIRGGETVIRAGMGDSPGR
GAPERRHKAQPGRARKYEWRPEGPTSMGSLGQREDLQDEDRNSAFTWKVQANNRAYNGQF
KEKVILCWQRKKYKTNVIRTAKYNFYSFLPLNLYEQFHRVSNLFFLIIIILQSIPDISTL
PWFSLSTPMVCLLFIRATRDLVDDMGRHKSDRAINNRPCQILMGKSFKQKKWQDLCVGDV
VCLRKDNIVPADMLLLASTEPSSLCYVETVDIDGETNLKFRQALMVTHKELATIKKMASF
QGTVTCEAPNSRMHHFVGCLEWNDKKYSLDIGNLLLRGCRIRNTDTCYGLVIYAGFDTKI
MKNCGKIHLKRTKLDLLMNKLVVVIFISVVLVCLVLAFGFGFSVKEFKDHHYYLSGVHGS
SVAAESFFVFWSFLILLSVTIPMSMFILSEFIYLGNSVFIDWDVQMYYKPQDVPAKARST
SLNDHLGQVEYIFSDKTGTLTQNILTFNKCCISGRVYGPDSEATTRPKENPYLWNKFADG
KLLFHNAALLHLVRTNGDEAVREFWRLLAICHTVMVRESPRERPDQLLYQAASPDEGALV
TAARNFGYVFLSRTQDTVTIMELGEERVYQVLAIMDFNSTRKRMSVLVRKPEGAICLYTK
GADTVIFERLHRRGAMEFATEEALAAFAQETLRTLCLAYREVAEDIYEDWQQRHQEASLL
LQNRAQALQQLLGATAIEDRLQDGVPETIKCLKKSNIKIWVLTGDKQETAVNIGFACELL
SENMLILEEKEISRILETYWENSNNLLTRESLSQVKLALVINGDFLDKLLVSLRKEPRAL
AQNVNMDEAWQELGQSRRDFLYARRLSLLCRRFGLPLAAPPAQDSRARRSSEVLQERAFV
DLASKCQAVICCRVTPKQKALIVALVKKYHQVVTLAIGDGANDINMIKTADVGVGLAGQE
GMQAVQNSDFVLGQFCFLQRLLLVHGRWSYVRICKFLRYFFYKSMASMMVQVWFACYNGF
TGQPLYEGWFLALFNLLYSTLPVLYIGLFEQDVSAEQSLEKPELYVVGQKDELFNYWVFV
QAIAHGVTTSLVNFFMTLWISRDTAGPASFSDHQSFAVVVALSCLLSITMEVILIIKYWT
ALCVATILLSLGFYAIMTTTTQSFWLFRVSPTTFPFLYADLSVMSSPSILLVVLLSVSIN
TFPVLALRVIFPALKELRAKEEKVEEGPSEEIFTMEPLPHVHRESRARRSSYAFSHREGY
ANLITQGTILRRGPGVSSDIASESLDPSDEEAASSPKESQ
GenBank ID Protein 44888835
UniProtKB/Swiss-Prot ID O60423
UniProtKB/Swiss-Prot Entry Name AT8B3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_138813.2
GeneCard ID ATP8B3
GenAtlas ID ATP8B3
HGNC ID HGNC:13535
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]