You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01491
Secondary Accession Numbers
  • 6787
Name Ribosomal protein S6 kinase alpha-5
Synonyms
  1. 90 kDa ribosomal protein S6 kinase 5
  2. Nuclear mitogen- and stress-activated protein kinase 1
  3. RSK-like protein kinase
  4. RSKL
  5. S6K-alpha-5
Gene Name RPS6KA5
Protein Type Unknown
Biological Properties
General Function Involved in protein serine/threonine kinase activity
Specific Function Serine/threonine kinase required for the mitogen or stress-induced phosphorylation of the transcription factors CREB (cAMP response element-binding protein) and ATF1 (activating transcription factor-1). Essential role in the control of RELA transcriptional activity in response to TNF. Directly represses transcription via phosphorylation of 'Ser-1' of histone H2A. Phosphorylates 'Ser-10' of histone H3 in response to mitogenics, stress stimuli and epidemal growth-factor (EGF), which results in the transcriptional activation of several immediate early genes, including proto-oncogenes c-fos/FOS and c-jun/JUN. May also phosphorylate 'Ser-28' of histone H3. Mediates the mitogen- and stress-induced phosphorylation of high mobility group protein 14 (HMG-14)
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
magnesium ion binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
signaling process
signal transmission
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
signal transmission via phosphorylation event
intracellular protein kinase cascade
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 14q31-q32.1
SNPs RPS6KA5
Gene Sequence
>2409 bp
ATGGAGGAGGAGGGTGGCAGCAGCGGCGGCGCCGCGGGGACCAGCGCGGACGGCGGCGAC
GGAGGAGAGCAGCTCCTCACTGTCAAGCACGAGCTGCGGACTGCTAATTTGACAGGACAT
GCTGAGAAGGTGGGAATAGAAAATTTTGAGCTCCTGAAGGTCCTAGGAACTGGAGCTTAT
GGAAAAGTATTTCTAGTTCGTAAAATAAGTGGCCATGATACTGGAAAGCTGTATGCCATG
AAAGTTTTGAAAAAGGCAACAATCGTTCAAAAGGCCAAAACCACAGAGCATACAAGGACA
GAACGACAAGTCCTGGAACACATTAGGCAGTCGCCATTTTTGGTAACATTACATTATGCT
TTCCAGACAGAAACCAAACTTCATCTCATTTTAGATTATATAAATGGTGGTGAACTTTTT
ACTCATCTTTCTCAAAGAGAGCGTTTCACAGAGCATGAGGTGCAGATTTATGTTGGAGAG
ATTGTGCTTGCCCTCGAACATCTCCACAAGTTGGGGATTATATATCGTGATATTAAGCTT
GAGAATATTCTACTTGATTCTAATGGCCATGTGGTGCTGACAGATTTTGGTCTGAGTAAG
GAGTTTGTGGCTGATGAAACTGAAAGAGCATATTCCTTTTGTGGAACTATTGAATACATG
GCACCAGATATTGTCAGAGGGGGAGATTCAGGACATGACAAGGCAGTTGACTGGTGGAGT
TTGGGTGTTCTAATGTATGAATTACTAACTGGAGCATCTCCTTTCACTGTTGATGGAGAA
AAAAATTCCCAAGCTGAGATATCTAGGAGAATATTAAAAAGTGAGCCTCCATATCCCCAA
GAAATGAGTGCTTTAGCGAAAGACCTAATTCAGCGTCTTTTGATGAAAGATCCCAAGAAG
AGATTGGGATGTGGTCCACGTGATGCAGATGAAATCAAAGAACATCTCTTCTTTCAGAAA
ATAAATTGGGATGATTTAGCCGCCAAAAAAGTGCCTGCACCATTTAAGCCAGTCATTCGA
GATGAATTAGATGTGAGTAACTTTGCAGAAGAGTTCACAGAAATGGATCCCACTTATTCT
CCCGCAGCCCTGCCCCAGAGTTCTGAGAAGCTGTTTCAGGGCTATTCCTTTGTTGCTCCT
TCCATCCTATTCAAGCGTAATGCAGCTGTCATAGACCCTCTTCAGTTTCACATGGGAGTT
GAACGTCCTGGAGTGACAAATGTTGCCAGGAGTGCAATGATGAAGGACTCTCCATTCTAT
CAACACTATGACCTAGATTTGAAGGACAAACCCCTGGGAGAAGGTAGTTTTTCAATTTGT
CGAAAGTGTGTGCATAAAAAAAGTAACCAAGCTTTTGCAGTCAAAATAATCAGCAAAAGG
ATGGAAGCCAATACTCAAAAGGAAATAACAGCTCTGAAACTCTGTGAAGGACACCCCAAT
ATTGTGAAGTTGCATGAAGTTTTTCATGATCAGCTTCACACGTTTCTAGTGATGGAACTT
CTGAATGGAGGAGAACTGTTTGAGCGCATTAAGAAAAAGAAGCACTTCAGTGAGACGGAA
GCCAGCTACATCATGAGGAAGCTTGTTTCAGCTGTAAGCCACATGCATGATGTTGGAGTG
GTGCACAGGGATCTGAAACCTGAGAATTTATTGTTCACCGATGAAAATGACAATTTGGAA
ATTAAAATAATTGATTTTGGATTTGCACGGCTAAAGCCACCGGATAATCAGCCCCTGAAG
ACTCCATGCTTCACCCTTCATTATGCCGCCCCAGAGCTCTTGAATCAGAACGGCTACGAT
GAGTCCTGTGACCTGTGGAGCTTGGGCGTCATTTTGTACACAATGTTGTCAGGACAGGTT
CCCTTCCAATCTCATGACCGAAGTTTGACGTGTACCAGCGCGGTGGAAATCATGAAGAAA
ATTAAAAAGGGAGATTTCTCCTTTGAAGGAGAAGCCTGGAAGAATGTATCCCAAGAGGCT
AAAGATTTGATCCAAGGACTTCTCACAGTAGATCCAAACAAAAGGCTTAAAATGTCTGGC
TTGAGGTACAATGAATGGCTACAAGATGGAAGTCAGCTGTCCTCCAATCCTCTGATGACT
CCGGATATTCTAGGATCTTCCGGAGCTGCCGTGCATACCTGTGTGAAAGCAACCTTCCAC
GCCTTTAACAAATACAAGAGAGAGGGGTTTTGCCTTCAGAATGTTGATAAGGCCCCTTTG
GCTAAGAGAAGAAAAATGAAAAAGACTAGCACCAGTACCGAGACGCGCAGCAGTTCCAGT
GAGAGTTCCCATTCTTCTTCCTCTCATTCTCACGGTAAAACTACACCCACCAAGACACTG
CAGCCCAGCAATCCTGCCGACAGCAATAACCCGGAGACCCTCTTCCAGTTCTCGGACTCA
GTAGCTTAG
Protein Properties
Number of Residues 802
Molecular Weight 89864.7
Theoretical pI 7.1
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ribosomal protein S6 kinase alpha-5
MEEEGGSSGGAAGTSADGGDGGEQLLTVKHELRTANLTGHAEKVGIENFELLKVLGTGAY
GKVFLVRKISGHDTGKLYAMKVLKKATIVQKAKTTEHTRTERQVLEHIRQSPFLVTLHYA
FQTETKLHLILDYINGGELFTHLSQRERFTEHEVQIYVGEIVLALEHLHKLGIIYRDIKL
ENILLDSNGHVVLTDFGLSKEFVADETERAYSFCGTIEYMAPDIVRGGDSGHDKAVDWWS
LGVLMYELLTGASPFTVDGEKNSQAEISRRILKSEPPYPQEMSALAKDLIQRLLMKDPKK
RLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIRDELDVSNFAEEFTEMDPTYS
PAALPQSSEKLFQGYSFVAPSILFKRNAAVIDPLQFHMGVERPGVTNVARSAMMKDSPFY
QHYDLDLKDKPLGEGSFSICRKCVHKKSNQAFAVKIISKRMEANTQKEITALKLCEGHPN
IVKLHEVFHDQLHTFLVMELLNGGELFERIKKKKHFSETEASYIMRKLVSAVSHMHDVGV
VHRDLKPENLLFTDENDNLEIKIIDFGFARLKPPDNQPLKTPCFTLHYAAPELLNQNGYD
ESCDLWSLGVILYTMLSGQVPFQSHDRSLTCTSAVEIMKKIKKGDFSFEGEAWKNVSQEA
KDLIQGLLTVDPNKRLKMSGLRYNEWLQDGSQLSSNPLMTPDILGSSGAAVHTCVKATFH
AFNKYKREGFCLQNVDKAPLAKRRKMKKTSTSTETRSSSSESSHSSSSHSHGKTTPTKTL
QPSNPADSNNPETLFQFSDSVA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O75582
UniProtKB/Swiss-Prot Entry Name KS6A5_HUMAN
PDB IDs
GenBank Gene ID AF074393
GeneCard ID RPS6KA5
GenAtlas ID RPS6KA5
HGNC ID HGNC:10434
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  3. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  4. Deak M, Clifton AD, Lucocq LM, Alessi DR: Mitogen- and stress-activated protein kinase-1 (MSK1) is directly activated by MAPK and SAPK2/p38, and may mediate activation of CREB. EMBO J. 1998 Aug 3;17(15):4426-41. [PubMed:9687510 ]
  5. Soloaga A, Thomson S, Wiggin GR, Rampersaud N, Dyson MH, Hazzalin CA, Mahadevan LC, Arthur JS: MSK2 and MSK1 mediate the mitogen- and stress-induced phosphorylation of histone H3 and HMG-14. EMBO J. 2003 Jun 2;22(11):2788-97. [PubMed:12773393 ]
  6. New L, Zhao M, Li Y, Bassett WW, Feng Y, Ludwig S, Padova FD, Gram H, Han J: Cloning and characterization of RLPK, a novel RSK-related protein kinase. J Biol Chem. 1999 Jan 8;274(2):1026-32. [PubMed:9873047 ]
  7. Jiang C, Yu L, Tu Q, Zhao Y, Zhang H, Zhao S: Assignment of a member of the ribosomal protein S6 kinase family, RPS6KA5, to human chromosome 14q31-->q32.1 by radiation hybrid mapping. Cytogenet Cell Genet. 1999;87(3-4):261-2. [PubMed:10702687 ]
  8. Wiggin GR, Soloaga A, Foster JM, Murray-Tait V, Cohen P, Arthur JS: MSK1 and MSK2 are required for the mitogen- and stress-induced phosphorylation of CREB and ATF1 in fibroblasts. Mol Cell Biol. 2002 Apr;22(8):2871-81. [PubMed:11909979 ]
  9. Vermeulen L, De Wilde G, Van Damme P, Vanden Berghe W, Haegeman G: Transcriptional activation of the NF-kappaB p65 subunit by mitogen- and stress-activated protein kinase-1 (MSK1). EMBO J. 2003 Mar 17;22(6):1313-24. [PubMed:12628924 ]
  10. Zhang Y, Griffin K, Mondal N, Parvin JD: Phosphorylation of histone H2A inhibits transcription on chromatin templates. J Biol Chem. 2004 May 21;279(21):21866-72. Epub 2004 Mar 9. [PubMed:15010469 ]
  11. McCoy CE, Campbell DG, Deak M, Bloomberg GB, Arthur JS: MSK1 activity is controlled by multiple phosphorylation sites. Biochem J. 2005 Apr 15;387(Pt 2):507-17. [PubMed:15568999 ]