You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01527
Secondary Accession Numbers
  • 6823
Name Mitogen-activated protein kinase 6
Synonyms
  1. ERK-3
  2. Extracellular signal-regulated kinase 3
  3. MAP kinase 6
  4. MAP kinase isoform p97
  5. MAPK 6
  6. p97-MAPK
Gene Name MAPK6
Protein Type Unknown
Biological Properties
General Function Involved in MAP kinase activity
Specific Function Phosphorylates microtubule-associated protein 2 (MAP2). May promote entry in the cell cycle
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
receptor signaling protein serine/threonine kinase activity
map kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 15q21
SNPs MAPK6
Gene Sequence
>2166 bp
ATGGCAGAGAAATTTGAAAGTCTCATGAACATTCATGGTTTTGATCTGGGTTCTAGGTAT
ATGGACTTAAAACCATTGGGTTGTGGAGGCAATGGCTTGGTTTTTTCTGCTGTAGACAAT
GACTGTGACAAAAGAGTAGCCATCAAGAAAATTGTCCTTACTGATCCCCAGAGTGTCAAA
CATGCTCTACGTGAAATCAAAATTATTAGAAGACTTGACCATGATAACATTGTGAAAGTG
TTTGAGATTCTTGGTCCCAGTGGAAGCCAATTAACAGACGATGTGGGCTCTCTTACGGAA
CTGAACAGTGTTTACATTGTTCAGGAGTACATGGAGACAGACTTGGCTAATGTGCTGGAG
CAGGGCCCTTTACTGGAAGAGCATGCCAGGCTTTTCATGTATCAGCTGCTACGGGGGCTC
AAGTATATTCACTCTGCAAATGTACTGCACAGAGATCTCAAACCAGCTAATCTTTTCATT
AATACGGAAGACTTGGTGCTGAAGATAGGTGACTTTGGTCTTGCACGGATCATGGATCCT
CATTATTCCCATAAGGGTCATCTTTCTGAAGGATTGGTTACTAAATGGTACAGATCTCCA
CGTCTTTTACTTTCTCCTAATAATTATACTAAAGCCATTGACATGTGGGCTGCAGGCTGC
ATCTTTGCTGAAATGCTGACTGGTAAAACCCTTTTTGCAGGTGCACATGAACTTGAACAG
ATGCAGCTGATTTTAGAATCTATTCCTGTTGTACATGAGGAAGATCGTCAGGAGCTTCTC
AGCGTAATTCCAGTTTACATTAGAAATGACATGACTGAGCCACACAAACCTTTAACTCAG
CTGCTTCCAGGAATTAGTCGAGAAGCACTGGATTTCCTGGAACAAATTTTGACATTTAGC
CCCATGGATCGGTTAACAGCAGAAGAAGCACTCTCCCATCCTTACATGAGCATATATTCT
TTTCCAATGGATGAGCCAATTTCAAGCCATCCTTTTCATATTGAAGATGAAGTTGATGAT
ATTTTGCTTATGGATGAAACTCACAGTCACATTTATAACTGGGAAAGGTATCATGATTGT
CAGTTTTCAGAGCATGATTGGCCTGTACATAACAACTTTGATATTGATGAAGTTCAGCTT
GATCCAAGAGCTCTGTCCGATGTCACTGATGAAGAAGAAGTACAAGTTGATCCCCGAAAA
TATTTGGATGGAGATCGGGAAAAGTATCTGGAGGATCCTGCTTTTGATACCAATTACTCT
ACTGAGCCTTGTTGGCAATACTCAGATCATCATGAAAACAAATATTGTGATCTGGAGTGT
AGCCATACTTGTAACTACAAAACGAGGTCATCATCATATTTAGATAACTTAGTTTGGAGA
GAGAGTGAAGTTAACCATTACTATGAACCCAAGCTTATTATAGATCTTTCCAATTGGAAA
GAACAAAGCAAAGAAAAATCTGATAAGAAAGGCAAATCAAAATGTGAAAGGAATGGATTG
GTTAAAGCCCAGATAGCGCTAGAGGAAGCATCACAGCAACTGGCTGGAAAAGAAAGGGAA
AAGAATCAGGGATTTGATTTTGATTCCTTTATTGCAGGAACTATTCAGCTTAGTTCCCAG
CATGAGCCTACTGATGTTGTTGATAAATTAAATGACTTGAATAGCTCAGTGTCCCAACTA
GAATTGAAAAGTTTGATATCAAAGTCAGTAAGCCAAGAAAAACAGGAAAAAGGAATGGCA
AATCTGGCTCAATTAGAAGCCTTGTACCAGTCTTCTTGGGACAGCCAGTTTGTGAGTGGT
GGGGAGGACTGTTTTTTCATAAATCAGTTTTGTGAGGTAAGGAAGGATGAACAAGTTGAG
AAGGAAAACACTTACACTAGTTACTTGGACAAGTTCTTTAGCAGGAAAGAAGATACTGAA
ATGCTAGAAACTGAGCCAGTAGAGGATGGGAAGCTTGGGGAGAGAGGACATGAGGAAGGA
TTTCTGAACAACAGTGGGGAGTTCCTCTTTAACAAGCAGCTCGAGTCCATAGGCATCCCA
CAGTTTCACAGTCCAGTTGGGTCACCACTTAAGTCAATACAGGCCACATTAACACCTTCT
GCTATGAAATCTTCCCCTCAAATTCCTCATCAAACATACAGCAGCATTCTGAAACATCTG
AACTAA
Protein Properties
Number of Residues 721
Molecular Weight 82680.1
Theoretical pI 4.67
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Mitogen-activated protein kinase 6
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLE
QGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLSVIPVYIRNDMTEPHKPLTQLLPGISREALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDC
QFSEHDWPVHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTNYS
TEPCWQYSDHHENKYCDLECSHTCNYKTRSSSYLDNLVWRESEVNHYYEPKLIIDLSNWK
EQSKEKSDKKGKSKCERNGLVKAQIALEEASQQLAGKEREKNQGFDFDSFIAGTIQLSSQ
HEPTDVVDKLNDLNSSVSQLELKSLISKSVSQEKQEKGMANLAQLEALYQSSWDSQFVSG
GEDCFFINQFCEVRKDEQVEKENTYTSYLDKFFSRKEDTEMLETEPVEDGKLGERGHEEG
FLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHQTYSSILKHL
N
GenBank ID Protein 763113
UniProtKB/Swiss-Prot ID Q16659
UniProtKB/Swiss-Prot Entry Name MK06_HUMAN
PDB IDs Not Available
GenBank Gene ID X80692
GeneCard ID MAPK6
GenAtlas ID MAPK6
HGNC ID HGNC:6879
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  5. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  6. Zhu AX, Zhao Y, Moller DE, Flier JS: Cloning and characterization of p97MAPK, a novel human homolog of rat ERK-3. Mol Cell Biol. 1994 Dec;14(12):8202-11. [PubMed:7969157 ]
  7. Meloche S, Beatty BG, Pellerin J: Primary structure, expression and chromosomal locus of a human homolog of rat ERK3. Oncogene. 1996 Oct 3;13(7):1575-9. [PubMed:8875998 ]