You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01540
Secondary Accession Numbers
  • 6836
Name Isopentenyl-diphosphate Delta-isomerase 2
Synonyms
  1. IPP isomerase 2
  2. IPPI2
  3. Isopentenyl pyrophosphate isomerase 2
Gene Name IDI2
Protein Type Unknown
Biological Properties
General Function Lipid transport and metabolism
Specific Function Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP).
Pathways
  • dimethylallyl diphosphate biosynthesis
  • Terpenoid backbone biosynthesis
Reactions
Isopentenyl pyrophosphate → Dimethylallylpyrophosphate details
GO Classification
Biological Process
isoprenoid biosynthetic process
cholesterol biosynthetic process
dimethylallyl diphosphate biosynthetic process
Cellular Component
cytosol
peroxisome
Function
catalytic activity
hydrolase activity
intramolecular oxidoreductase activity, transposing c=c bonds
isopentenyl-diphosphate delta-isomerase activity
isomerase activity
intramolecular oxidoreductase activity
Molecular Function
metal ion binding
isopentenyl-diphosphate delta-isomerase activity
hydrolase activity
Process
metabolic process
primary metabolic process
lipid metabolic process
cellular lipid metabolic process
isoprenoid metabolic process
isoprenoid biosynthetic process
Cellular Location
  1. Peroxisome
Gene Properties
Chromosome Location 10
Locus 10p15.3
SNPs IDI2
Gene Sequence
>684 bp
ATGTCTGACATAAATCTTGACTGGGTTGACAGGCGTCAGTTGCAGCGCTTGGAGGAAATG
CTGATTGTTGTGGATGAGAATGATAAGGTTATTGGTGCCGACACCAAGAGGAATTGCCAT
CTGAACGAAAACATTGAGAAAGGGCTGCTGCACCGAGCCTTCAGCGTTGTCTTGTTTAAC
ACCAAGAATCGAATCCTGATACAGCAGAGGTCGGACACGAAAGTCACGTTTCCTGGGTAT
TTTACCGACTCCTGTAGTAGCCACCCATTATACAACCCAGCAGAACTGGAAGAAAAGGAT
GCCATCGGAGTGAGGAGGGCAGCCCAGAGGCGTCTGCAAGCAGAGCTGGGAATTCCTGGG
GAACAGATTTCTCCAGAGGACATTGTGTTCATGACAATCTATCACCACAAGGCAAAATCA
GACAGAATTTGGGGAGAGCATGAAATTTGTTACCTTCTGCTTGTGAGGAAAAACGTCACT
CTGAACCCGGATCCCAGTGAAACGAAAAGCATCCTCTACCTGTCCCAGGAGGAGCTGTGG
GAGCTGCTGGAGAGGGAGGCGAGGGGTGAAGTCAAAGTCACCCCCTGGCTAAGAACCATT
GCCGAGAGGTTTCTGTACCGGTGGTGGCCTCACCTGGATGACGTGACCCCGTTTGTGGAG
CTTCACAAAATACACAGAGTGTGA
Protein Properties
Number of Residues 227
Molecular Weight 26752.33
Theoretical pI 6.453
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Isopentenyl-diphosphate Delta-isomerase 2
MSDINLDWVDRRQLQRLEEMLIVVDENDKVIGADTKRNCHLNENIEKGLLHRAFSVVLFN
TKNRILIQQRSDTKVTFPGYFTDSCSSHPLYNPAELEEKDAIGVRRAAQRRLQAELGIPG
EQISPEDIVFMTIYHHKAKSDRIWGEHEICYLLLVRKNVTLNPDPSETKSILYLSQEELW
ELLEREARGEVKVTPWLRTIAERFLYRWWPHLDDVTPFVELHKIHRV
GenBank ID Protein 13925769
UniProtKB/Swiss-Prot ID Q9BXS1
UniProtKB/Swiss-Prot Entry Name IDI2_HUMAN
PDB IDs
GenBank Gene ID AF271725
GeneCard ID IDI2
GenAtlas ID Not Available
HGNC ID HGNC:23487
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Clizbe DB, Owens ML, Masuda KR, Shackelford JE, Krisans SK: IDI2, a second isopentenyl diphosphate isomerase in mammals. J Biol Chem. 2007 Mar 2;282(9):6668-76. Epub 2007 Jan 3. [PubMed:17202134 ]