Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01545
Secondary Accession Numbers
  • 6841
Name Cytochrome P450 4F11
Synonyms
  1. CYPIVF11
Gene Name CYP4F11
Protein Type Unknown
Biological Properties
General Function Secondary metabolites biosynthesis, transport and catabolism
Specific Function Not Available
Pathways
  • Arachidonic acid metabolism
Reactions
RH + reduced flavoprotein + Oxygen → ROH + oxidized flavoprotein + Water details
Leukotriene B4 + NADPH + Hydrogen Ion + Oxygen → 20-Hydroxy-leukotriene B4 + NADP + Water details
Arachidonic acid + Oxygen + NADPH + Hydrogen Ion → 20-Hydroxyeicosatetraenoic acid + NADP + Water details
GO Classification
Biological Process
small molecule metabolic process
inflammatory response
xenobiotic metabolic process
Cellular Component
endoplasmic reticulum membrane
integral to membrane
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
electron carrier activity
iron ion binding
monooxygenase activity
heme binding
oxidoreductase activity
Molecular Function
electron carrier activity
monooxygenase activity
aromatase activity
iron ion binding
heme binding
Process
metabolic process
oxidation reduction
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Single-pass membrane protein
  3. Single-pass membrane protein
  4. Microsome membrane
Gene Properties
Chromosome Location 19
Locus 19p13.1
SNPs CYP4F11
Gene Sequence
>1575 bp
ATGCCGCAGCTGAGCCTGTCCTGGCTGGGCCTCGGGCCCGTGGCAGCATCCCCGTGGCTG
CTTCTGCTGCTGGTTGGGGGCTCCTGGCTCCTGGCCCGCGTCCTGGCCTGGACCTACACC
TTCTATGACAACTGCCGCCGCCTCCAGTGTTTTCCTCAACCCCCGAAACAGAACTGGTTT
TGGGGACACCAGGGCCTGGTCACTCCCACGGAAGAGGGCATGAAGACATTGACCCAGCTG
GTGACCACATATCCCCAGGGCTTTAAGTTGTGGCTGGGTCCTACCTTCCCCCTCCTCATT
TTATGCCACCCTGACATTATCCGGCCTATCACCAGTGCCTCAGCTGCTGTCGCACCCAAG
GATATGATTTTCTATGGCTTCCTGAAGCCCTGGCTGGGGGATGGGCTCCTGCTGAGTGGT
GGTGACAAGTGGAGCCGCCACCGTCGGATGTTGACGCCTGCCTTCCATTTCAACATCTTG
AAGCCTTATATGAAGATTTTCAACAAGAGTGTGAACATCATGCACGACAAGTGGCAGCGC
CTGGCCTCAGAGGGCAGCGCCAGACTGGACATGTTTGAACACATCAGCCTCATGACCTTG
GACAGTCTGCAGAAATGTGTCTTCAGCTTTGAAAGCAATTGTCAGGAGAAGCCCAGTGAA
TATATTGCCGCCATCTTGGAGCTCAGTGCCTTTGTAGAAAAGAGAAACCAGCAGATTCTC
TTGCACACGGACTTCCTGTATTATCTCACTCCTGATGGGCAGCGCTTCCGCAGGGCCTGC
CACCTGGTGCACGACTTCACAGATGCCGTCATCCAGGAGCGGCGCTGCACCCTCCCCACT
CAGGGTATTGATGATTTCCTCAAGAACAAGGCAAAGTCCAAGACTTTAGACTTCATTGAT
GTGCTTCTGCTGAGCAAGGATGAAGATGGGAAGGAATTGTCTGATGAGGACATAAGAGCA
GAAGCTGACACCTTCATGTTTGAGGGCCATGACACTACAGCCAGTGGTCTCTCCTGGGTC
CTATACCACCTTGCAAAGCACCCAGAATACCAGGAACAGTGCCGGCAAGAAGTGCAAGAG
CTTCTGAAGGACCGTGAACCTATAGAGATTGAATGGGACGACCTGGCCCAGCTGCCCTTC
CTGACCATGTGCATTAAGGAGAGCCTGCGGTTGCATCCCCCAGTCCCGGTCATCTCCCGA
TGTTGCACGCAGGACTTTGTGCTCCCAGACGGCCGCGTCATCCCCAAAGGCATTGTCTGC
CTCATCAATATTATCGGGATCCATTACAACCCAACTGTGTGGCCAGACCCTGAGGTCTAC
GACCCCTTCCGTTTCGACCAAGAGAACATCAAGGAGAGGTCACCTCTGGCTTTTATTCCC
TTCTCGGCAGGGCCCAGAAACTGCATCGGGCAGGCGTTCGCCATGGCTGAGATGAAGGTG
GTCCTGGCGCTCACCCTGCTGCACTTCCGCATCCTGCCGACCCACACTGAACCCCGCAGG
AAACCCGAGCTGATATTGCGCGCAGAGGGTGGACTTTGGCTGCGGGTGGAGCCCCTGGGT
GCGAACTCACAGTGA
Protein Properties
Number of Residues 524
Molecular Weight 60145.165
Theoretical pI 6.722
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Cytochrome P450 4F11
MPQLSLSWLGLGPVAASPWLLLLLVGGSWLLARVLAWTYTFYDNCRRLQCFPQPPKQNWF
WGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLILCHPDIIRPITSASAAVAPK
DMIFYGFLKPWLGDGLLLSGGDKWSRHRRMLTPAFHFNILKPYMKIFNKSVNIMHDKWQR
LASEGSARLDMFEHISLMTLDSLQKCVFSFESNCQEKPSEYIAAILELSAFVEKRNQQIL
LHTDFLYYLTPDGQRFRRACHLVHDFTDAVIQERRCTLPTQGIDDFLKNKAKSKTLDFID
VLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQEQCRQEVQE
LLKDREPIEIEWDDLAQLPFLTMCIKESLRLHPPVPVISRCCTQDFVLPDGRVIPKGIVC
LINIIGIHYNPTVWPDPEVYDPFRFDQENIKERSPLAFIPFSAGPRNCIGQAFAMAEMKV
VLALTLLHFRILPTHTEPRRKPELILRAEGGLWLRVEPLGANSQ
GenBank ID Protein 193083180
UniProtKB/Swiss-Prot ID Q9HBI6
UniProtKB/Swiss-Prot Entry Name CP4FB_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001128932.1
GeneCard ID CYP4F11
GenAtlas ID Not Available
HGNC ID HGNC:13265
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  3. Cui X, Nelson DR, Strobel HW: A novel human cytochrome P450 4F isoform (CYP4F11): cDNA cloning, expression, and genomic structural characterization. Genomics. 2000 Sep 1;68(2):161-6. [PubMed:10964514 ]