You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01600
Secondary Accession Numbers
  • 6919
Name Lysozyme C
Synonyms
  1. 1,4-beta-N-acetylmuramidase C
Gene Name LYZ
Protein Type Enzyme
Biological Properties
General Function Involved in lysozyme activity
Specific Function Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte- macrophage system and enhance the activity of immunoagents
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing o-glycosyl compounds
lysozyme activity
Process
metabolic process
catabolic process
cell wall macromolecule catabolic process
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:1
Locus 12q15
SNPs LYZ
Gene Sequence
>447 bp
ATGAAGGCTCTCATTGTTCTGGGGCTTGTCCTCCTTTCTGTTACGGTCCAGGGCAAGGTC
TTTGAAAGGTGTGAGTTGGCCAGAACTCTGAAAAGATTGGGAATGGATGGCTACAGGGGA
ATCAGCCTAGCAAACTGGATGTGTTTGGCCAAATGGGAGAGTGGTTACAACACACGAGCT
ACAAACTACAATGCTGGAGACAGAAGCACTGATTATGGGATATTTCAGATCAATAGCCGC
TACTGGTGTAATGATGGCAAAACCCCAGGAGCAGTTAATGCCTGTCATTTATCCTGCAGT
GCTTTGCTGCAAGATAACATCGCTGATGCTGTAGCTTGTGCAAAGAGGGTTGTCCGTGAT
CCACAAGGCATTAGAGCATGGGTGGCATGGAGAAATCGTTGTCAAAACAGAGATGTCCGT
CAGTATGTTCAAGGTTGTGGAGTGTAA
Protein Properties
Number of Residues 148
Molecular Weight 16536.9
Theoretical pI 9.35
Pfam Domain Function
Signals
  • 1-18
Transmembrane Regions
  • None
Protein Sequence
>Lysozyme C
MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRA
TNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRD
PQGIRAWVAWRNRCQNRDVRQYVQGCGV
GenBank ID Protein 13278744
UniProtKB/Swiss-Prot ID P61626
UniProtKB/Swiss-Prot Entry Name LYSC_HUMAN
PDB IDs
GenBank Gene ID BC004147
GeneCard ID LYZ
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Castanon MJ, Spevak W, Adolf GR, Chlebowicz-Sledziewska E, Sledziewski A: Cloning of human lysozyme gene and expression in the yeast Saccharomyces cerevisiae. Gene. 1988 Jun 30;66(2):223-34. [PubMed:2971592 ]
  3. Chung LP, Keshav S, Gordon S: Cloning the human lysozyme cDNA: inverted Alu repeat in the mRNA and in situ hybridization for macrophages and Paneth cells. Proc Natl Acad Sci U S A. 1988 Sep;85(17):6227-31. [PubMed:3413092 ]
  4. Yoshimura K, Toibana A, Nakahama K: Human lysozyme: sequencing of a cDNA, and expression and secretion by Saccharomyces cerevisiae. Biochem Biophys Res Commun. 1988 Jan 29;150(2):794-801. [PubMed:2829884 ]
  5. Peters CW, Kruse U, Pollwein R, Grzeschik KH, Sippel AE: The human lysozyme gene. Sequence organization and chromosomal localization. Eur J Biochem. 1989 Jul 1;182(3):507-16. [PubMed:2546758 ]
  6. Canfield RE, Kammerman S, Sobel JH, Morgan FJ: Primary structure of lysozymes from man and goose. Nat New Biol. 1971 Jul 7;232(27):16-7. [PubMed:5284421 ]
  7. Thomsen J, Lund EH, Kristiansen K, Brunfeldt K, Malmquist J: A val-val sequence found in a human monocytic leukemia lysozyme. FEBS Lett. 1972 Apr 15;22(1):34-36. [PubMed:11946554 ]
  8. Jolles J, Jolles P: Human milk lysozyme: unpublished data concerning the establishment of the complete primary structure; comparison with lysozymes of various origins. Helv Chim Acta. 1971;54(8):2668-75. [PubMed:5168859 ]
  9. Jolles J, Jolles P: Comparison between human and bird lysozymes: Note concerning the previously observed deletion. FEBS Lett. 1972 Apr 15;22(1):31-33. [PubMed:11946553 ]
  10. Kanaya E, Ishihara K, Tsunasawa S, Nokihara K, Kikuchi M: Indication of possible post-translational formation of disulphide bonds in the beta-sheet domain of human lysozyme. Biochem J. 1993 Jun 1;292 ( Pt 2):469-76. [PubMed:8503881 ]
  11. Artymiuk PJ, Blake CC: Refinement of human lysozyme at 1.5 A resolution analysis of non-bonded and hydrogen-bond interactions. J Mol Biol. 1981 Nov 15;152(4):737-62. [PubMed:7334520 ]
  12. Blake CC, Pulford WC, Artymiuk PJ: X-ray studies of water in crystals of lysozyme. J Mol Biol. 1983 Jul 5;167(3):693-723. [PubMed:6876162 ]
  13. Inaka K, Taniyama Y, Kikuchi M, Morikawa K, Matsushima M: The crystal structure of a mutant human lysozyme C77/95A with increased secretion efficiency in yeast. J Biol Chem. 1991 Jul 5;266(19):12599-603. [PubMed:2061330 ]
  14. Steinrauf LK: Structures of monoclinic lysozyme iodide at 1.6 A and of triclinic lysozyme nitrate at 1.1 A. Acta Crystallogr D Biol Crystallogr. 1998 Sep 1;54(Pt 5):767-80. [PubMed:9757091 ]
  15. Redfield C, Dobson CM: 1H NMR studies of human lysozyme: spectral assignment and comparison with hen lysozyme. Biochemistry. 1990 Aug 7;29(31):7201-14. [PubMed:2207098 ]
  16. Ohkubo T, Taniyama Y, Kikuchi M: 1H and 15N NMR study of human lysozyme. J Biochem. 1991 Dec;110(6):1022-9. [PubMed:1794972 ]
  17. Pepys MB, Hawkins PN, Booth DR, Vigushin DM, Tennent GA, Soutar AK, Totty N, Nguyen O, Blake CC, Terry CJ, et al.: Human lysozyme gene mutations cause hereditary systemic amyloidosis. Nature. 1993 Apr 8;362(6420):553-7. [PubMed:8464497 ]