You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01604
Secondary Accession Numbers
  • 6927
Name Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
Synonyms
  1. Asparagine-linked glycosylation protein 3 homolog
  2. Dol-P-Man-dependent alpha(1-3)-mannosyltransferase
  3. Dolichyl-phosphate-mannose--glycolipid alpha-mannosyltransferase
  4. Not56-like protein
  5. Dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase
Gene Name ALG3
Protein Type Enzyme
Biological Properties
General Function Involved in transferase activity, transferring hexosyl groups
Specific Function Adds the first Dol-P-Man derived mannose in an alpha-1,3 linkage to Man5GlcNAc2-PP-Dol.
Pathways
  • N-Glycan biosynthesis
  • protein glycosylation
Reactions
Dolichyl phosphate D-mannose + D-Man-alpha-(1->2)-D-Man-alpha-(1->2)-D-Man-alpha-(1->3)-(D-Man-alpha-(1->6))-D-Man-beta-(1->4)-D-GlcNAc-beta-(1->4)-D-GlcNAc-diphosphodolichol → D-Man-alpha-(1->2)-D-Man-alpha-(1->2)-D-Man-alpha-(1->3)-(D-Man-alpha-(1->3)-D-Man-alpha-(1->6))-D-Man-beta-(1->4)-D-GlcNAc-beta-(1->4)-D-GlcNAc-diphosphodolichol + Dolichol-20 details
Dolichyl phosphate D-mannose + → Dolichyl phosphate + details
GO Classification
Biological Process
dolichol-linked oligosaccharide biosynthetic process
post-translational protein modification
protein N-linked glycosylation via asparagine
Cellular Component
endoplasmic reticulum membrane
integral to membrane
Component
cell part
membrane part
endoplasmic reticulum
intrinsic to membrane
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
integral to membrane
Function
catalytic activity
transferase activity
transferase activity, transferring hexosyl groups
transferase activity, transferring glycosyl groups
Molecular Function
alpha-1,3-mannosyltransferase activity
dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase activity
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Multi-pass membrane protein (Probable)
Gene Properties
Chromosome Location 3
Locus 3q27.1
SNPs ALG3
Gene Sequence
>1317 bp
ATGGCGGCTGGGCTGCGGAAACGCGGCCGGTCCGGTTCCGCGGCCCAGGCAGAGGGACTC
TGCAAGCAATGGCTGCAGCGCGCCTGGCAAGAGCGGCGCCTGCTGCTGCGGGAGCCGCGC
TACACGCTGCTGGTGGCCGCCTGCCTCTGCCTGGCGGAGGTGGGCATCACCTTCTGGGTC
ATTCACAGGGTGGCATACACAGAGATTGACTGGAAGGCCTACATGGCCGAGGTAGAAGGC
GTCATCAATGGTACCTATGACTATACCCAACTGCAGGGTGACACCGGACCACTTGTGTAC
CCAGCTGGTTTCGTGTACATCTTTATGGGGTTGTACTATGCCACCAGCCGAGGCACTGAC
ATCCGCATGGCCCAGAACATCTTTGCTGTGCTCTACCTGGCTACCTTGCTGCTTGTCTTC
TTGATCTATCACCAGACCTGCAAGGTACCTCCCTTCGTCTTTTTCTTCATGTGCTGCGCC
TCTTACCGTGTCCACTCCATCTTTGTGCTGCGGCTCTTCAATGACCCAGTGGCCATGGTG
CTGCTCTTCCTCAGTATCAACCTCCTGCTGGCCCAGCGCTGGGGCTGGGGTTGCTGCTTT
TTCAGCCTGGCAGTCTCTGTGAAGATGAATGTGCTGCTCTTCGCCCCTGGGTTACTGTTT
CTTCTCCTCACACAGTTTGGCTTCCGTGGGGCCCTCCCCAAGCTGGGAATCTGTGCTGGC
CTTCAGGTGGTGCTGGGGCTGCCCTTCCTGCTGGAGAACCCCAGCGGCTACCTGTCCCGC
TCCTTTGACCTTGGCCGCCAGTTTCTGTTCCACTGGACAGTGAACTGGCGCTTCCTCCCA
GAGGCGCTCTTCCTGCATCGAGCCTTCCACCTGGCCCTGTTGACTGCCCACCTCACCCTG
CTCCTGCTGTTTGCCCTCTGCAGGTGGCACAGGACAGGGGAAAGTATCTTGTCGCTGCTG
AGGGATCCCTCCAAAAGGAAGGTTCCACCCCAGCCCCTTACACCCAACCAGATCGTTTCT
ACCCTCTTCACCTCCAACTTCATTGGCATCTGCTTCAGCCGCTCCCTCCACTACCAGTTC
TACGTCTGGTATTTCCACACACTGCCCTACCTCCTGTGGGCCATGCCTGCACGCTGGCTC
ACACACCTGCTCAGGTTGTTGGTGCTGGGGCTCATCGAGCTCTCCTGGAACACATACCCT
TCCACATCCTGCAGCTCTGCTGCCCTGCACATATGCCATGCCGTCATCCTGCTGCAGCTC
TGGCTGGGCCCGCAGCCTTTCCCCAAGAGCACCCAACACAGCAAGAAAGCCCACTGA
Protein Properties
Number of Residues 438
Molecular Weight 44369.995
Theoretical pI 8.939
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase
MAAGLRKRGRSGSAAQAEGLCKQWLQRAWQERRLLLREPRYTLLVAACLCLAEVGITFWV
IHRVAYTEIDWKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTD
IRMAQNIFAVLYLATLLLVFLIYHQTCKVPPFVFFFMCCASYRVHSIFVLRLFNDPVAMV
LLFLSINLLLAQRWGWGCCFFSLAVSVKMNVLLFAPGLLFLLLTQFGFRGALPKLGICAG
LQVVLGLPFLLENPSGYLSRSFDLGRQFLFHWTVNWRFLPEALFLHRAFHLALLTAHLTL
LLLFALCRWHRTGESILSLLRDPSKRKVPPQPLTPNQIVSTLFTSNFIGICFSRSLHYQF
YVWYFHTLPYLLWAMPARWLTHLLRLLVLGLIELSWNTYPSTSCSSAALHICHAVILLQL
WLGPQPFPKSTQHSKKAH
GenBank ID Protein 12803981
UniProtKB/Swiss-Prot ID Q92685
UniProtKB/Swiss-Prot Entry Name ALG3_HUMAN
PDB IDs Not Available
GenBank Gene ID BC002839
GeneCard ID ALG3
GenAtlas ID ALG3
HGNC ID HGNC:23056
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  4. Korner C, Knauer R, Stephani U, Marquardt T, Lehle L, von Figura K: Carbohydrate deficient glycoprotein syndrome type IV: deficiency of dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase. EMBO J. 1999 Dec 1;18(23):6816-22. [PubMed:10581255 ]
  5. Sun L, Eklund EA, Chung WK, Wang C, Cohen J, Freeze HH: Congenital disorder of glycosylation id presenting with hyperinsulinemic hypoglycemia and islet cell hyperplasia. J Clin Endocrinol Metab. 2005 Jul;90(7):4371-5. Epub 2005 Apr 19. [PubMed:15840742 ]