You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01611
Secondary Accession Numbers
  • 6934
Name Ribose-5-phosphate isomerase
Synonyms
  1. Phosphoriboisomerase
Gene Name RPIA
Protein Type Enzyme
Biological Properties
General Function Involved in ribose-5-phosphate isomerase activity
Specific Function Not Available
Pathways
  • Glucose-6-phosphate dehydrogenase deficiency
  • Pentose Phosphate Pathway
  • Pentose phosphate pathway
  • Ribose-5-phosphate isomerase deficiency
  • Transaldolase deficiency
  • Warburg Effect
Reactions
D-Ribose 5-phosphate → D-Ribulose 5-phosphate details
GO Classification
Biological Process
pentose-phosphate shunt, non-oxidative branch
ribose phosphate metabolic process
Cellular Component
cytosol
Function
catalytic activity
isomerase activity
intramolecular oxidoreductase activity
intramolecular oxidoreductase activity, interconverting aldoses and ketoses
ribose-5-phosphate isomerase activity
Molecular Function
ribose-5-phosphate isomerase activity
monosaccharide binding
Process
metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
pentose metabolic process
pentose-phosphate shunt, non-oxidative branch
Cellular Location Not Available
Gene Properties
Chromosome Location 2
Locus 2p11.2
SNPs RPIA
Gene Sequence
>936 bp
ATGCAGCGCCCCGGGCCCTTCAGCACCCTCTACGGGCGGGTCTTGGCCCCGCTGCCCGGG
AGGGCCGGGGGCGCGGCCTCCGGCGGAGGAGGGAACAGCTGGGACCTCCCGGGTTCCCAC
GTGCGGCTGCCGGGGCGTGCACAGTCTGGGACCCGTGGCGGTGCTGGCAACACAAGCACC
AGCTGCGGGGACTCCAACAGCATCTGCCCGGCCCCCTCCACGATGTCCAAGGCCGAGGAG
GCCAAGAAGCTGGCGGGCCGCGCGGCTGTGGAGAACCACGTGAGGAATAACCAAGTGCTG
GGAATTGGAAGTGGTTCTACAATTGTCCATGCTGTGCAGCGAATAGCTGAAAGGGTGAAG
CAAGAGAATCTGAACCTCGTCTGTATTCCCACTTCCTTCCAGGCCCGCCAGCTCATCCTG
CAGTATGGCTTGACCCTCAGTGATCTGGATCGACACCCAGAGATCGACCTTGCCATCGAT
GGTGCTGATGAAGTAGATGCTGATCTCAATCTCATCAAGGGTGGCGGAGGCTGCCTGACC
CAGGAGAAGATTGTGGCTGGCTATGCTAGTCGCTTCATCGTGATCGCTGATTTCAGGAAA
GATTCGAAGAATCTCGGGGATCAGTGGCACAAGGGAATCCCCATCGAGGTCATCCCAATG
GCCTATGTCCCAGTGAGCCGAGCTGTGAGCCAGAAGTTTGGGGGCGTGGTTGAACTTCGA
ATGGCTGTCAACAAGGCTGGTCCTGTGGTGACAGATAATGGGAATTTTATCTTGGACTGG
AAGTTTGACCGGGTACACAAATGGAGTGAAGTGAATACAGCTATCAAAATGATCCCAGGT
GTGGTGGACACAGGCCTATTCATCAACATGGCTGAGAGAGTCTACTTTGGGATGCAGGAT
GGCTCAGTGAACATGAGGGAGAAGCCTTTCTGTTGA
Protein Properties
Number of Residues 311
Molecular Weight 33268.72
Theoretical pI 8.538
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Ribose-5-phosphate isomerase
MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSGTRGGAGNTST
SCGDSNSICPAPSTMSKAEEAKKLAGRAAVENHVRNNQVLGIGSGSTIVHAVQRIAERVK
QENLNLVCIPTSFQARQLILQYGLTLSDLDRHPEIDLAIDGADEVDADLNLIKGGGGCLT
QEKIVAGYASRFIVIADFRKDSKNLGDQWHKGIPIEVIPMAYVPVSRAVSQKFGGVVELR
MAVNKAGPVVTDNGNFILDWKFDRVHKWSEVNTAIKMIPGVVDTGLFINMAERVYFGMQD
GSVNMREKPFC
GenBank ID Protein 94536842
UniProtKB/Swiss-Prot ID P49247
UniProtKB/Swiss-Prot Entry Name RPIA_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_144563.2
GeneCard ID RPIA
GenAtlas ID RPIA
HGNC ID HGNC:10297
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Apel TW, Scherer A, Adachi T, Auch D, Ayane M, Reth M: The ribose 5-phosphate isomerase-encoding gene is located immediately downstream from that encoding murine immunoglobulin kappa. Gene. 1995 Apr 24;156(2):191-7. [PubMed:7758956 ]
  3. Huck JH, Verhoeven NM, Struys EA, Salomons GS, Jakobs C, van der Knaap MS: Ribose-5-phosphate isomerase deficiency: new inborn error in the pentose phosphate pathway associated with a slowly progressive leukoencephalopathy. Am J Hum Genet. 2004 Apr;74(4):745-51. Epub 2004 Feb 25. [PubMed:14988808 ]