You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01637
Secondary Accession Numbers
  • 6962
Name A-kinase anchor protein 9
Synonyms
  1. A-kinase anchor protein 350 kDa
  2. A-kinase anchor protein 450 kDa
  3. AKAP 120-like protein
  4. AKAP 350
  5. AKAP 450
  6. AKAP-9
  7. CG-NAP
  8. Centrosome- and Golgi-localized PKN-associated protein
  9. PRKA9
  10. Protein hyperion
  11. Protein kinase A-anchoring protein 9
  12. Protein yotiao
  13. hgAKAP 350
Gene Name AKAP9
Protein Type Enzyme
Biological Properties
General Function Cell cycle control, cell division, chromosome partitioning
Specific Function Binds to type II regulatory subunits of protein kinase A. Scaffolding protein that assembles several protein kinases and phosphatases on the centrosome and Golgi apparatus. May be required to maintain the integrity of the Golgi apparatus. Isoform 4 is associated with the N-methyl-D-aspartate receptor and is specifically found in the neuromuscular junction (NMJ) as well as in neuronal synapses, suggesting a role in the organization of postsynaptic specializations
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cytoplasm
  2. Cytoplasm
  3. Golgi apparatus
  4. cytoskeleton
  5. centrosome
Gene Properties
Chromosome Location Chromosome:7
Locus 7q21-q22
SNPs AKAP9
Gene Sequence
>11736 bp
ATGGAGGACGAGGAGAGACAGAAGAAGCTGGAGGCCGGCAAAGCCAAGATTGAAGAACTC
TCTTTAGCTTTTCTTGTCAGACAGCTTGCCCAGTTTCGACAAAGAAAAGCTCAGTCGGAT
GGGCAGAGTCCTTCCAAGAAGCAGAAAAAAAAGAGAAAAACGTCAAGCAGTAAACATGAT
GTGTCAGCACACCATGATTTGAATATTGATCAATCACAGTGTAATGAAATGTACATAAAT
AGTTCTCAGAGAGTAGAATCAACTGTGATTCCTGAATCTACAATAATGAGAACTCTACAT
AGTGGAGAAATAACCAGTCATGAGCAGGGCTTCTCTGTGGAACTGGAAAGTGAAATTTCA
ACCACAGCAGATGACTGCAGTTCAGAGGTAAATGGTTGCAGTTTTGTGATGAGAACAGGA
AAGCCTACAAATTTATTAAGGGAAGAAGAATTTGGTGTTGATGATTCTTATTCTGAACAA
GGAGCACAAGACAGTCCGACTCATCTAGAGATGATGGAAAGTGAGTTGGCTGGGAAGCAG
CATGAGATTGAAGAGCTAAACAGAGAGCTGGAAGAAATGAGGGTTACCTATGGGACTGAA
GGACTGCAGCAGTTACAAGAATTTGAAGCTGCCATTAAACAAAGAGATGGCATTATAACC
CAGCTCACTGCTAATTTACAACAAGCAAGAAGAGAAAAGGATGAGACAATGAGAGAATTT
TTAGAGTTGACAGAACAGAGTCAAAAATTACAGATTCAATTTCAGCAATTACAGGCTAGT
GAAACTCTGAGAAACAGCACTCATAGTAGCACAGCTGCAGACTTACTACAAGCCAAACAA
CAGATCCTCACTCATCAACAGCAGCTTGAAGAACAAGACCACTTATTAGAAGATTATCAG
AAAAAGAAAGAAGACTTCACAATGCAAATTAGTTTCTTGCAAGAGAAAATTAAAGTATAT
GAAATGGAACAAGATAAAAAAGTAGAAAACTCAAATAAAGAAGAAATACAGGAAAAGGAG
ACAATCATTGAAGAATTAAACACAAAAATAATAGAAGAAGAAAAGAAAACTCTTGAGCTA
AAGGATAAATTAACAACTGCTGATAAATTACTAGGAGAATTACAAGAACAGATTGTGCAA
AAGAACCAAGAAATAAAAAACATGAAATTAGAGCTGACTAATTCTAAGCAAAAAGAAAGA
CAGTCTTCTGAAGAAATAAAACAGTTAATGGGGACAGTCGAAGAACTTCAGAAGAGAAAT
CATAAAGACAGCCAGTTCGAAACTGATATAGTACAACGAATGGAACAAGAAACACAAAGA
AAGTTAGAACAACTCCGGGCAGAGCTGGATGAGATGTATGGGCAGCAGATAGTGCAAATG
AAACAAGAATTAATAAGACAACACATGGCACAGATGGAGGAAATGAAAACACGGCATAAG
GGAGAAATGGAGAATGCTTTAAGGTCATATTCAAATATTACAGTTAATGAAGATCAGATA
AAGTTAATGAATGTGGCAATAAATGAACTGAATATAAAATTGCAAGATACTAACTCTCAA
AAGGAAAAACTCAAGGAAGAACTAGGACTAATTTTAGAAGAAAAGTGTGCTCTACAGAGA
CAGCTTGAAGACCTTGTTGAAGAATTGAGCTTTTCAAGGGAACAGATTCAGAGAGCTAGA
CAGACAATAGCTGAACAAGAAAGTAAACTTAATGAAGCACATAAGTCCCTTAGTACAGTG
GAAGATTTGAAAGCTGAGATTGTTTCTGCATCTGAATCCAGAAAGGAACTAGAATTAAAA
CATGAAGCAGAAGTTACAAATTACAAGATAAAACTTGAAATGTTAGAAAAAGAAAAGAAT
GCTGTGTTAGACAGAATGGCTGAATCACAAGAAGCTGAATTAGAGAGGCTGAGAACACAG
CTTCTATTTAGTCACGAAGAAGAGCTTTCCAAACTGAAGGAAGATTTAGAAATTGAACAT
CGAATAAATATTGAAAAACTTAAAGATAATTTAGGCATTCACTATAAACAGCAGATAGAT
GGTTTACAGAATGAAATGAGTCAAAAGATAGAAACCATGCAGTTTGAAAAGGACAATTTG
ATAACTAAGCAGAATCAATTAATTTTGGAAATTTCAAAGCTAAAAGATTTACAGCAGTCT
CTTGTAAATTCAAAGTCAGAAGAAATGACTCTTCAAATCAATGAACTTCAAAAAGAAATT
GAAATACTCAGACAAGAAGAAAAAGAAAAGGGTACACTTGAACAAGAAGTTCAAGAATTA
CAACTTAAAACAGAATTGTTAGAAAAACAGATGAAGGAAAAAGAGAATGATCTTCAAGAA
AAATTTGCACAACTTGAAGCAGAGAATAGCATTCTTAAAGATGAAAAGAAAACCCTTGAA
GACATGTTGAAAATACATACTCCTGTTAGCCAAGAAGAAAGATTGATTTTCTTAGACTCC
ATTAAGTCCAAATCCAAAGACTCTGTGTGGGAAAAAGAAATAGAAATACTTATAGAGGAA
AATGAGGACCTCAAACAACAATGTATTCAGCTAAATGAAGAGATTGAAAAGCAAAGGAAC
ACTTTTTCATTTGCTGAAAAAAACTTTGAAGTTAACTATCAAGAGTTACAAGAGGAGTAT
GCTTGCCTTCTCAAAGTAAAAGATGATTTAGAAGACAGTAAAAATAAACAGGAATTAGAG
TATAAAAGTAAACTTAAAGCACTTAATGAAGAGCTTCATTTGCAAAGAATAAATCCAACT
ACAGTGAAAATGAAAAGTTCTGTCTTTGATGAAGACAAAACTTTTGTAGCAGAAACATTG
GAAATGGGTGAGGTTGTTGAAAAGGATACAACAGAACTCATGGAAAAACTTGAGGTAACC
AAGCGAGAGAAATTAGAGCTGTCACAGAGACTGTCTGATCTTTCTGAACAATTGAAACAG
AAACATGGTGAGATTAGTTTTCTAAATGAAGAAGTTAAATCTTTAAAGCAAGAGAAAGAA
CAAGTTTCATTGAGATGTAGAGAGCTAGAAATCATTATTAACCACAACAGGGCAGAAAAT
GTACAGTCATGTGATACTCAAGTAAGCTCTTTATTAGATGGAGTTGTGACCATGACAAGC
AGGGGTGCTGAAGGATCAGTTTCTAAAGTAAATAAAAGTTTTGGTGAAGAATCAAAAATA
ATGGTGGAAGATAAAGTTTCTTTTGAAAATATGACTGTTGGAGAAGAAAGTAAGCAAGAA
CAGTTGATTTTGGATCACTTACCATCTGTAACAAAGGAATCATCACTTAGAGCAACTCAA
CCAAGTGAAAATGATAAACTTCAGAAAGAACTCAATGTACTTAAATCAGAACAGAATGAT
TTAAGGCTACAGATGGAAGCCCAACGCATTTGCCTCTCTCTGGTTTATTCAACTCATGTG
GATCAGGTTCGTGAATATATGGAAAATGAAAAAGATAAAGCTCTTTGCAGTCTTAAAGAA
GAGCTTATTTTTGCTCAAGAGGAAAAGATCAAGGAACTTCAGAAAATACACCAGTTAGAA
CTACAGACTATGAAAACACAAGAAACAGGTGATGAAGGAAAGCCTTTACATCTGCTCATT
GGAAAACTTCAAAAGGCAGTGTCTGAAGAATGTTCTTATTTTTTACAGACTTTATGCAGT
GTCCTTGGTGAATATTATACTCCTGCTTTAAAATGTGAAGTAAATGCAGAAGACAAAGAG
AATTCTGGTGATTACATTTCTGAAAATGAAGATCCAGAATTACAAGATTATAGATATGAA
GTTCAAGACTTTCAAGAAAATATGCACACTCTTCTCAACAAAGTAACAGAAGAATACAAC
AAACTCTTGGTACTTCAAACACGACTAAGCAAGATCTGGGGACAGCAGACAGATGGTATG
AAACTTGAATTTGGAGAAGAAAACCTTCCAAAAGAGGAAACAGAGTTTTTATCAATCCAT
TCTCAGATGACCAATTTGGAAGACATTGATGTCAATCATAAAAGCAAGTTATCTTCTCTG
CAAGATCTTGAAAAAACTAAACTTGAAGAACAAGTTCAAGAATTAGAAAGCCTCATATCC
TCTTTGCAGCAACAGTTGAAAGAAACTGAACAAAACTATGAGGCAGAGATCCACTGTTTA
CAGAAGAGGCTTCAAGCTGTTAGTGAGTCCACGGTTCCGCCAAGCTTACCTGTTGATTCG
GTGGTAATTACAGAATCTGATGCACAGAGAACAATGTACCCTGGAAGTTGTGTGAAAAAG
AATATTGATGGTACAATAGAGTTTTCTGGTGAATTTGGAGTGAAAGAGGAAACAAATATC
GTTAAGTTGCTTGAAAAACAATACCAAGAACAATTAGAAGAAGAAGTAGCTAAGGTTATT
GTGTCAATGAGTATAGCATTTGCTCAACAAACTGAACTGTCTAGAATATCTGGGGGAAAA
GAAAATACTGCATCATCAAAGCAAGCACATGCTGTGTGTCAGCAAGAACAACATTATTTT
AATGAAATGAAATTATCACAGGATCAAATTGGTTTTCAGACTTTTGAGACAGTGGATGTG
AAATTTAAAGAAGAATTTAAACCACTTAGTAAAGAGTTAGGAGAACATGGAAAGGAAATT
TTATTATCAAATAGTGATCCCCATGATATACCAGAATCAAAGGACTGTGTGCTGACTATT
TCAGAAGAAATGTTCTCCAAAGATAAAACATTTATAGTTAGACAGTCTATTCATGATGAG
ATTTCAGTGTCAAGCATGGATGCTTCTAGACAACTAATGTTGAATGAAGAACAGTTGGAA
GATATGAGACAGGAACTTGTACGACAATACCAAGAACATCAACAGGCAACGGAATTGTTA
AGGCAAGCACATATGCGGCAAATGGAGAGACAGCGAGAAGACCAGGAACAGCTACAAGAA
GAGATTAAGAGACTTAATAGACAATTAGCCCAGAGATCCTCCATAGATAATGAAAACCTG
GTTTCAGAGAGAGAGAGGGTGCTTTTAGAGGAGCTGGAAGCACTAAAGCAGCTGTCTTTA
GCTGGAAGAGAGAAGCTGTGTTGTGAGCTGCGCAACAGCAGTACGCAAACACAGAATGGA
AATGAAAACCAAGGAGAAGTTGAAGAACAAACATTTAAAGAAAAGGAATTAGACAGAAAA
CCTGAAGATGTGCCTCCTGAGATTTTGTCTAATGAAAGGTATGCACTCCAGAAAGCTAAT
AATAGACTTTTGAAGATCCTCTTAGAAGTTGTAAAGACAACAGCAGCTGTTGAAGAAACA
ATTGGTCGCCATGTCCTTGGGATTCTAGATAGATCTAGTAAAAGCCAGTCATCTGCCAGC
CTAATTTGGAGGTCAGAAGCAGAGGCATCTGTAAAGTCATGTGTCCATGAGGAACATACA
AGAGTTACAGATGAATCCATTCCCTCTTATTCTGGAAGTGATATGCCAAGAAATGACATT
AACATGTGGTCAAAAGTAACTGAGGAAGGAACAGAGCTGTCACAACGACTTGTGAGGAGT
GGTTTTGCTGGAACTGAAATAGACCCTGAAAATGAAGAACTTATGCTGAACATTAGCTCT
CGACTACAAGCAGCAGTTGAAAAACTCCTAGAAGCCATAAGTGAAACTAGCAGTCAGCTT
GAACATGCGAAAGTGACACAGACAGAGTTGATGCGTGAGTCATTTAGACAGAAACAAGAA
GCAACAGAGTCCCTTAAGTGCCAAGAGGAACTTCGAGAGCGCCTTCATGAGGAGTCCAGG
GCCAGAGAACAGCTAGCTGTGGAGCTCAGTAAGGCTGAGGGCGTCATTGATGGCTATGCA
GATGAAAAAACTCTTTTTGAAAGGCAAATTCAGGAAAAAACTGATATAATAGATCGTCTT
GAGCAGGAGTTGTTATGTGCAAGTAACAGGTTGCAAGAATTGGAGGCAGAGCAACAGCAG
ATCCAAGAAGAAAGAGAATTACTGTCCAGACAAAAGGAAGCTATGAAAGCAGAGGCAGGC
CCAGTTGAACAACAATTACTACAGGAGACAGAAAAATTAATGAAGGAAAAACTAGAAGTA
CAATGTCAAGCTGAAAAAGTACGTGATGACCTTCAAAAACAAGTGAAAGCTCTAGAAATA
GATGTGGAAGAACAAGTCAGTAGGTTTATAGAGCTGGAACAAGAAAAAAATACTGAACTA
ATGGATTTAAGACAGCAAAACCAAGCATTGGAAAAGCAGTTAGAAAAAATGAGAAAATTT
TTAGATGAGCAAGCCATTGACAGAGAACATGAGAGAGATGTATTCCAACAGGAAATACAG
AAACTAGAACAGCAACTTAAGGTTGTTCCTCGATTCCAGCCTATCAGTGAACATCAAACT
AGAGAGGTTGAACAGTTAGCAAATCATCTGAAAGAAAAAACAGACAAATGCAGTGAGCTT
TTGCTCTCTAAAGAGCAGCTTCAAAGGGATATACAAGAAAGGAATGAAGAAATAGAGAAA
CTGGAGTTCAGAGTAAGAGAACTGGAGCAGGCGCTTCTTGTGAGTGCAGATACTTTTCAA
AAGGTAGAGGACCGAAAACACTTTGGAGCTGTAGAAGCTAAACCAGAATTGTCCCTAGAA
GTACAATTGCAGGCTGAACGAGATGCCATAGACAGAAAGGAAAAAGAGATTACAAACTTA
GAAGAGCAATTAGAACAGTTTAGAGAAGAACTGGAAAATAAGAATGAAGAAGTTCAACAA
TTACATATGCAATTAGAAATACAGAAAAAGGAATCTACTACCCGCCTACAAGAACTTGAA
CAGGAAAACAAATTATTTAAGGATGACATGGAGAAACTGGGACTTGCCATAAAGGAATCT
GATGCCATGTCTACTCAAGACCAACATGTGCTATTTGGGAAATTTGCTCAAATAATACAG
GAAAAAGAGGTAGAAATTGACCAATTAAATGAACAAGTTACGAAACTCCAGCAGCAACTT
AAAATTACAACAGATAACAAGGTTATTGAAGAAAAAAATGAACTGATAAGGGATCTTGAA
ACCCAAATAGAATGTTTGATGAGTGATCAAGAATGTGTGAAGAGAAATAGAGAAGAAGAA
ATAGAGCAGCTCAATGAAGTGATTGAAAAACTTCAACAGGAATTGGCAAATATTGGACAG
AAGACATCAATGAATGCTCATTCCCTCTCAGAAGAAGCAGACAGTTTAAAACATCAATTG
GATGTGGTTATAGCTGAAAAGCTGGCCTTGGAACAGCAAGTAGAAACCGCTAATGAAGAA
ATGACCTTCATGAAAAATGTACTTAAAGAAACCAATTTTAAAATGAATCAGCTAACACAG
GAATTATTCAGCTTAAAGAGAGAACGTGAAAGTGTGGAAAAGATTCAAAGCATACCAGAG
AATAGTGTTAACGTGGCTATAGATCATCTGAGCAAAGACAAACCTGAACTAGAAGTAGTC
CTTACAGAGGATGCTCTTAAATCCCTAGAAAATCAGACATACTTCAAATCTTTTGAAGAA
AATGGCAAAGGTTCCATAATTAATTTGGAAACAAGGTTGCTACAACTTGAGAGCACTGTT
AGTGCAAAGGACTTAGAACTTACCCAGTGTTATAAACAAATAAAAGACATGCAAGAACAA
GGCCAGTTTGAAACAGAAATGCTTCAAAAGAAGATTGTAAACCTACAGAAAATAGTTGAA
GAAAAAGTGGCTGCTGCTCTTGTCAGTCAAATCCAACTTGAGGCAGTTCAGGAATATGCA
AAATTCTGTCAAGATAATCAAACAATTTCATCAGAACCTGAAAGAACAAATATTCAGAAT
TTAAATCAACTAAGAGAAGATGAGTTGGGGTCAGATATATCAGCATTAACCTTGAGAATA
TCAGAATTAGAAAGCCAGGTTGTTGAAATGCATACTAGTTTGATTTTAGAAAAAGAACAA
GTAGAAATTGCAGAAAAAAATGTTTTAGAAAAAGAAAAGAAGCTGCTAGAACTACAGAAG
CTATTGGAGGGCAATGAGAAAAAACAGAGAGAGAAAGAAAAGAAAAGAAGCCCTCAAGAT
GTTGAAGTTCTCAAGACAACTACTGAGCTATTTCATAGCAATGAAGAAAGTGGATTTTTT
AATGAACTCGAGGCTCTTAGAGCTGAATCAGTGGCTACCAAAGCAGAACTTGCCAGTTAT
AAAGAAAAGGCTGAAAAACTTCAAGAAGAGCTTTTGGTAAAAGAAACAAATATGACATCT
CTTCAGAAAGACTTAAGCCAAGTTAGGGATCACCTCGCAGAGGCAAAAGAGAAATTGTCC
ATTTTAGAAAAAGAAGATGAGACTGAGGTACAAGAAAGCAAAAAGGCCTGCATGTTTGAG
CCACTTCCTATAAAACTGAGTAAGAGCATTGCATCCCAGACAGATGGGACTCTGAAGATC
AGTAGCAGCAATCAGACTCCACAAATTCTTGTTAAAAATGCAGGAATACAAATTAATTTA
CAGAGTGAATGTTCCTCAGAAGAAGTTACTGAAATAATCAGTCAGTTTACTGAAAAAATT
GAGAAGATGCAAGAACTACATGCTGCTGAAATTTTGGACATGGAATCCAGACATATTTCA
GAAACTGAAACCTTAAAGAGGGAACACTATGTTGCCGTTCAGTTACTGAAAGAGGAATGT
GGTACCTTGAAGGCAGTGATACAGTGTCTGAGAAGTAAAGAGGTATTTGGTTTTTATAAT
ATGTGTTTTTCAACATTGTGTGATTCTGGATCAGACTGGGGTCAGGGAATTTATCTTACA
CACAGTCAGGGATTTGACATAGCATCAGAAGGCCGAGGAGAAGAAAGTGAAAGTGCAACA
GATTCCTTTCCAAAGAAAATAAAGGGATTACTGAGAGCTGTCCATAATGAAGGCATGCAG
GTGCTTTCTCTCACTGAGTCTCCCTATAGTGATGGAGAGGACCATTCTATTCAGCAGGTT
TCAGAACCTTGGCTAGAAGAGAGAAAAGCTTACATCAATACAATCTCATCTCTAAAGGAT
TTAATTACAAAGATGCAACTGCAAAGAGAAGCCGAGGTTTATGATAGTTCTCAATCTCAT
GAGAGCTTCTCAGACTGGCGAGGTGAACTACTGCTTGCCCTTCAACAAGTTTTCTTAGAA
GAGCGTAGTGTTTTACTAGCAGCATTTCGGACGGAGCTGACAGCTCTAGGTACTACAGAT
GCAGTTGGTTTACTAAACTGTTTGGAACAGAGAATACAAGAACAGGGTGTTGAATATCAA
GCAGCTATGGAATGCCTCCAGAAAGCAGATAGAAGGAGTTTGTTATCTGAAATTCAGGCA
CTGCATGCACAAATGAATGGTAGGAAAATTACTCTGAAAAGAGAACAAGAGAGTGAGAAA
CCAAGCCAAGAACTCTTGGAATATAATATACAGCAGAAGCAGTCTCAAATGCTGGAGATG
CAAGTGGAGCTCAGCAGTATGAAAGACAGAGCAACGGAACTGCAGGAGCAGCTGAGTTCT
GAGAAAATGGTGGTTGCTGAACTGAAGAGTGAGCTTGCACAAACTAAATTGGAACTAGAA
ACAACACTCAAGGCACAGCATAAACACCTAAAAGAATTGGAGGCTTTCAGGTTGGAAGTT
AAAGATAAGACAGATGAAGTACATTTGCTTAATGACACATTAGCAAGTGAACAGAAAAAA
TCAAGAGAGCTCCAGTGGGCTTTGGAGAAAGAGAAAGCCAAGTTGGGACGCAGTGAAGAA
CGGGATAAAGAAGAACTTGAGGATCTGAAGTTTTCACTTGAGAGTCAGAAACAAAGGAAT
CTTCAGCTAAATCTACTTTTGGAACAACAGAAACAACTACTGAACGAATCCCAGCAAAAA
ATAGAATCACAGAGAATGCTATATGATGCCCAGTTGTCAGAAGAACAAGGTCGAAACTTA
GAGCTTCAGGTACTTCTTGAATCTGAGAAAGTTCGAATTCGGGAAATGAGTAGTACCCTA
GATAGGGAGCGGGAATTGCACGCACAGCTGCAGAGCAGTGATGGTACTGGACAGTCTCGG
CCACCCTTGCCCTCAGAGGACCTACTGAAAGAGCTGCAGAAACAGCTAGAGGAAAAACAC
AGTCGCATAGTAGAATTGTTAAATGAGACTGAAAAATATAAACTGGATTCTTTGCAAACA
CGACAGCAAATGGAAAAAGATAGGCAGGTTCACAGGAAAACACTGCAGACAGAACAGGAG
GCCAACACTGAGGGACAGAAAAAAATGCATGAGCTCCAGTCCAAAGTGGAAGATCTTCAG
CGCCAGCTGGAAGAGAAAAGACAACAAGTTTATAAGTTAGACCTTGAAGGACAGCGACTA
CAAGGAATCATGCAGGAATTCCAGAAGCAAGAACTAGAACGAGAAGAAAAACGAGAAAGT
AGAAGAATTCTGTATCAGAACCTTAATGAGCCAACCACGTGGAGCTTAACCAGTGATAGA
ACTAGAAATTGGGTTCTTCAACAGAAAATAGAAGGAGAAACAAAAGAATCAAACTACGCT
AAATTGATTGAAATGAATGGAGGAGGAACCGGCTGTAATCATGAATTAGAAATGATCAGA
CAAAAGCTTCAATGTGTAGCTTCAAAACTACAGGTTCTACCCCAGAAAGCCTCTGAGAGA
CTACAGTTTGAAACAGCAGATGATGAAGATTTCATTTGGGTTCAGGAAAATATTGATGAA
ATTATTTTACAACTACAGAAATTAACTGGCCAGCAAGGTGAAGAGCCCAGCTTGGTGTCC
CCAAGTACTTCTTGTGGCTCATTGACTGAAAGACTACTGAGACAAAATGCTGAGCTGACA
GGGCATATCAGTCAACTGACTGAAGAGAAGAATGACTTAAGGAACATGGTTATGAAGCTG
GAAGAGCAGATCAGGTGGTATCGACAGACAGGAGCTGGTAGAGATAATTCTTCCAGGTTT
TCATTGAATGGTGGTGCCAACATTGAAGCCATCATTGCCTCTGAAAAAGAAGTATGGAAC
AGAGAAAAATTGACTCTCCAGAAATCTTTGAAAAGGGCAGAGGCTGAAGTATACAAACTG
AAAGCTGAACTAAGAAATGACTCTTTACTTCAAACTCTGAGCCCTGATTCTGAACATGTC
ACTTTAAAGAGAATTTATGGTAAATACTTGAGGGCAGAAAGTTTTCGAAAGGCTCTCATT
TACCAGAAGAAATACCTGCTGCTGTTACTGGGTGGGTTCCAGGAATGTGAAGATGCCACC
TTGGCCCTGCTTGCCCGGATGGGGGGGCAGCCAGCTTTCACGGATCTAGAGGTGATCACC
AATCGCCCAAAGGGCTTCACCAGGTTTCGGTCGGCCGTCAGAGTATCCATTGCAATTTCC
AGAATGAAATTTTTGGTTCGACGGTGGCATCGAGTCACAGGTTCTGTTTCCATCAATATT
AACAGAGATGGCTTTGGACTGAATCAAGGTGCAGAAAAGACTGACTCATTTTATCATTCT
TCTGGTGGGCTGGAGTTATATGGAGAACCAAGACATACTACGTATCGCTCAAGATCAGAT
CTGGACTATATTAGGTCCCCTTTACCATTTCAGAATAGGTACCCAGGCACTCCAGCTGAT
TTCAATCCTGGTTCTTTAGCATGTTCTCAGCTTCAGAATTACGATCCTGACAGAGCCCTA
ACAGATTATATCACTCGGCTAGAGGCACTGCAAAGACGACTTGGAACTATACAGTCAGGT
TCAACTACTCAATTTCATGCTGGCATGAGAAGATAA
Protein Properties
Number of Residues 3911
Molecular Weight 453664.2
Theoretical pI 4.65
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>A-kinase anchor protein 9
MEDEERQKKLEAGKAKIEELSLAFLVRQLAQFRQRKAQSDGQSPSKKQKKKRKTSSSKHD
VSAHHDLNIDQSQCNEMYINSSQRVESTVIPESTIMRTLHSGEITSHEQGFSVELESEIS
TTADDCSSEVNGCSFVMRTGKPTNLLREEEFGVDDSYSEQGAQDSPTHLEMMESELAGKQ
HEIEELNRELEEMRVTYGTEGLQQLQEFEAAIKQRDGIITQLTANLQQARREKDETMREF
LELTEQSQKLQIQFQQLQASETLRNSTHSSTAADLLQAKQQILTHQQQLEEQDHLLEDYQ
KKKEDFTMQISFLQEKIKVYEMEQDKKVENSNKEEIQEKETIIEELNTKIIEEEKKTLEL
KDKLTTADKLLGELQEQIVQKNQEIKNMKLELTNSKQKERQSSEEIKQLMGTVEELQKRN
HKDSQFETDIVQRMEQETQRKLEQLRAELDEMYGQQIVQMKQELIRQHMAQMEEMKTRHK
GEMENALRSYSNITVNEDQIKLMNVAINELNIKLQDTNSQKEKLKEELGLILEEKCALQR
QLEDLVEELSFSREQIQRARQTIAEQESKLNEAHKSLSTVEDLKAEIVSASESRKELELK
HEAEVTNYKIKLEMLEKEKNAVLDRMAESQEAELERLRTQLLFSHEEELSKLKEDLEIEH
RINIEKLKDNLGIHYKQQIDGLQNEMSQKIETMQFEKDNLITKQNQLILEISKLKDLQQS
LVNSKSEEMTLQINELQKEIEILRQEEKEKGTLEQEVQELQLKTELLEKQMKEKENDLQE
KFAQLEAENSILKDEKKTLEDMLKIHTPVSQEERLIFLDSIKSKSKDSVWEKEIEILIEE
NEDLKQQCIQLNEEIEKQRNTFSFAEKNFEVNYQELQEEYACLLKVKDDLEDSKNKQELE
YKSKLKALNEELHLQRINPTTVKMKSSVFDEDKTFVAETLEMGEVVEKDTTELMEKLEVT
KREKLELSQRLSDLSEQLKQKHGEISFLNEEVKSLKQEKEQVSLRCRELEIIINHNRAEN
VQSCDTQVSSLLDGVVTMTSRGAEGSVSKVNKSFGEESKIMVEDKVSFENMTVGEESKQE
QLILDHLPSVTKESSLRATQPSENDKLQKELNVLKSEQNDLRLQMEAQRICLSLVYSTHV
DQVREYMENEKDKALCSLKEELIFAQEEKIKELQKIHQLELQTMKTQETGDEGKPLHLLI
GKLQKAVSEECSYFLQTLCSVLGEYYTPALKCEVNAEDKENSGDYISENEDPELQDYRYE
VQDFQENMHTLLNKVTEEYNKLLVLQTRLSKIWGQQTDGMKLEFGEENLPKEETEFLSIH
SQMTNLEDIDVNHKSKLSSLQDLEKTKLEEQVQELESLISSLQQQLKETEQNYEAEIHCL
QKRLQAVSESTVPPSLPVDSVVITESDAQRTMYPGSCVKKNIDGTIEFSGEFGVKEETNI
VKLLEKQYQEQLEEEVAKVIVSMSIAFAQQTELSRISGGKENTASSKQAHAVCQQEQHYF
NEMKLSQDQIGFQTFETVDVKFKEEFKPLSKELGEHGKEILLSNSDPHDIPESKDCVLTI
SEEMFSKDKTFIVRQSIHDEISVSSMDASRQLMLNEEQLEDMRQELVRQYQEHQQATELL
RQAHMRQMERQREDQEQLQEEIKRLNRQLAQRSSIDNENLVSERERVLLEELEALKQLSL
AGREKLCCELRNSSTQTQNGNENQGEVEEQTFKEKELDRKPEDVPPEILSNERYALQKAN
NRLLKILLEVVKTTAAVEETIGRHVLGILDRSSKSQSSASLIWRSEAEASVKSCVHEEHT
RVTDESIPSYSGSDMPRNDINMWSKVTEEGTELSQRLVRSGFAGTEIDPENEELMLNISS
RLQAAVEKLLEAISETSSQLEHAKVTQTELMRESFRQKQEATESLKCQEELRERLHEESR
AREQLAVELSKAEGVIDGYADEKTLFERQIQEKTDIIDRLEQELLCASNRLQELEAEQQQ
IQEERELLSRQKEAMKAEAGPVEQQLLQETEKLMKEKLEVQCQAEKVRDDLQKQVKALEI
DVEEQVSRFIELEQEKNTELMDLRQQNQALEKQLEKMRKFLDEQAIDREHERDVFQQEIQ
KLEQQLKVVPRFQPISEHQTREVEQLANHLKEKTDKCSELLLSKEQLQRDIQERNEEIEK
LEFRVRELEQALLVSADTFQKVEDRKHFGAVEAKPELSLEVQLQAERDAIDRKEKEITNL
EEQLEQFREELENKNEEVQQLHMQLEIQKKESTTRLQELEQENKLFKDDMEKLGLAIKES
DAMSTQDQHVLFGKFAQIIQEKEVEIDQLNEQVTKLQQQLKITTDNKVIEEKNELIRDLE
TQIECLMSDQECVKRNREEEIEQLNEVIEKLQQELANIGQKTSMNAHSLSEEADSLKHQL
DVVIAEKLALEQQVETANEEMTFMKNVLKETNFKMNQLTQELFSLKRERESVEKIQSIPE
NSVNVAIDHLSKDKPELEVVLTEDALKSLENQTYFKSFEENGKGSIINLETRLLQLESTV
SAKDLELTQCYKQIKDMQEQGQFETEMLQKKIVNLQKIVEEKVAAALVSQIQLEAVQEYA
KFCQDNQTISSEPERTNIQNLNQLREDELGSDISALTLRISELESQVVEMHTSLILEKEQ
VEIAEKNVLEKEKKLLELQKLLEGNEKKQREKEKKRSPQDVEVLKTTTELFHSNEESGFF
NELEALRAESVATKAELASYKEKAEKLQEELLVKETNMTSLQKDLSQVRDHLAEAKEKLS
ILEKEDETEVQESKKACMFEPLPIKLSKSIASQTDGTLKISSSNQTPQILVKNAGIQINL
QSECSSEEVTEIISQFTEKIEKMQELHAAEILDMESRHISETETLKREHYVAVQLLKEEC
GTLKAVIQCLRSKEVFGFYNMCFSTLCDSGSDWGQGIYLTHSQGFDIASEGRGEESESAT
DSFPKKIKGLLRAVHNEGMQVLSLTESPYSDGEDHSIQQVSEPWLEERKAYINTISSLKD
LITKMQLQREAEVYDSSQSHESFSDWRGELLLALQQVFLEERSVLLAAFRTELTALGTTD
AVGLLNCLEQRIQEQGVEYQAAMECLQKADRRSLLSEIQALHAQMNGRKITLKREQESEK
PSQELLEYNIQQKQSQMLEMQVELSSMKDRATELQEQLSSEKMVVAELKSELAQTKLELE
TTLKAQHKHLKELEAFRLEVKDKTDEVHLLNDTLASEQKKSRELQWALEKEKAKLGRSEE
RDKEELEDLKFSLESQKQRNLQLNLLLEQQKQLLNESQQKIESQRMLYDAQLSEEQGRNL
ELQVLLESEKVRIREMSSTLDRERELHAQLQSSDGTGQSRPPLPSEDLLKELQKQLEEKH
SRIVELLNETEKYKLDSLQTRQQMEKDRQVHRKTLQTEQEANTEGQKKMHELQSKVEDLQ
RQLEEKRQQVYKLDLEGQRLQGIMQEFQKQELEREEKRESRRILYQNLNEPTTWSLTSDR
TRNWVLQQKIEGETKESNYAKLIEMNGGGTGCNHELEMIRQKLQCVASKLQVLPQKASER
LQFETADDEDFIWVQENIDEIILQLQKLTGQQGEEPSLVSPSTSCGSLTERLLRQNAELT
GHISQLTEEKNDLRNMVMKLEEQIRWYRQTGAGRDNSSRFSLNGGANIEAIIASEKEVWN
REKLTLQKSLKRAEAEVYKLKAELRNDSLLQTLSPDSEHVTLKRIYGKYLRAESFRKALI
YQKKYLLLLLGGFQECEDATLALLARMGGQPAFTDLEVITNRPKGFTRFRSAVRVSIAIS
RMKFLVRRWHRVTGSVSININRDGFGLNQGAEKTDSFYHSSGGLELYGEPRHTTYRSRSD
LDYIRSPLPFQNRYPGTPADFNPGSLACSQLQNYDPDRALTDYITRLEALQRRLGTIQSG
STTQFHAGMRR
GenBank ID Protein 4128008
UniProtKB/Swiss-Prot ID Q99996
UniProtKB/Swiss-Prot Entry Name AKAP9_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ010770
GeneCard ID AKAP9
GenAtlas ID AKAP9
HGNC ID HGNC:379
References
General References
  1. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  2. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  3. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  4. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Dohner H, Dohner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC: Human chromosome 7: DNA sequence and biology. Science. 2003 May 2;300(5620):767-72. Epub 2003 Apr 10. [PubMed:12690205 ]
  5. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948 ]
  6. Nagase T, Ishikawa K, Suyama M, Kikuno R, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Oct 30;5(5):277-86. [PubMed:9872452 ]
  7. Lin JW, Wyszynski M, Madhavan R, Sealock R, Kim JU, Sheng M: Yotiao, a novel protein of neuromuscular junction and brain that interacts with specific splice variants of NMDA receptor subunit NR1. J Neurosci. 1998 Mar 15;18(6):2017-27. [PubMed:9482789 ]
  8. Witczak O, Skalhegg BS, Keryer G, Bornens M, Tasken K, Jahnsen T, Orstavik S: Cloning and characterization of a cDNA encoding an A-kinase anchoring protein located in the centrosome, AKAP450. EMBO J. 1999 Apr 1;18(7):1858-68. [PubMed:10202149 ]
  9. Takahashi M, Shibata H, Shimakawa M, Miyamoto M, Mukai H, Ono Y: Characterization of a novel giant scaffolding protein, CG-NAP, that anchors multiple signaling enzymes to centrosome and the golgi apparatus. J Biol Chem. 1999 Jun 11;274(24):17267-74. [PubMed:10358086 ]
  10. Schmidt PH, Dransfield DT, Claudio JO, Hawley RG, Trotter KW, Milgram SL, Goldenring JR: AKAP350, a multiply spliced protein kinase A-anchoring protein associated with centrosomes. J Biol Chem. 1999 Jan 29;274(5):3055-66. [PubMed:9915845 ]
  11. Shanks RA, Larocca MC, Berryman M, Edwards JC, Urushidani T, Navarre J, Goldenring JR: AKAP350 at the Golgi apparatus. II. Association of AKAP350 with a novel chloride intracellular channel (CLIC) family member. J Biol Chem. 2002 Oct 25;277(43):40973-80. Epub 2002 Aug 5. [PubMed:12163479 ]
  12. Larocca MC, Shanks RA, Tian L, Nelson DL, Stewart DM, Goldenring JR: AKAP350 interaction with cdc42 interacting protein 4 at the Golgi apparatus. Mol Biol Cell. 2004 Jun;15(6):2771-81. Epub 2004 Mar 26. [PubMed:15047863 ]
  13. Chen L, Marquardt ML, Tester DJ, Sampson KJ, Ackerman MJ, Kass RS: Mutation of an A-kinase-anchoring protein causes long-QT syndrome. Proc Natl Acad Sci U S A. 2007 Dec 26;104(52):20990-5. Epub 2007 Dec 19. [PubMed:18093912 ]