You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01643
Secondary Accession Numbers
  • 6968
Name Glutamate [NMDA] receptor subunit epsilon-3
Synonyms
  1. N-methyl D-aspartate receptor subtype 2C
  2. NMDAR2C
  3. NR2C
Gene Name GRIN2C
Protein Type Unknown
Biological Properties
General Function Involved in ionotropic glutamate receptor activity
Specific Function NMDA receptor subtype of glutamate-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Mediated by glycine
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
periplasmic space
outer membrane-bounded periplasmic space
Function
receptor activity
transmembrane receptor activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
molecular transducer activity
signal transducer activity
transporter activity
ion channel activity
ligand-gated ion channel activity
extracellular ligand-gated ion channel activity
excitatory extracellular ligand-gated ion channel activity
extracellular-glutamate-gated ion channel activity
glutamate receptor activity
ionotropic glutamate receptor activity
Process
establishment of localization
transport
ion transport
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
  3. Multi-pass membrane protein
  4. Cell junction
  5. synapse
  6. postsynaptic cell membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 17q25
SNPs GRIN2C
Gene Sequence
>3711 bp
ATGGGTGGGGCCCTGGGGCCGGCCCTGTTGCTCACCTCGCTCTTCGGTGCCTGGGCAGGG
CTGGGTCCGGGGCAGGGCGAGCAGGGCATGACGGTGGCCGTGGTGTTTAGCAGCTCAGGG
CCGCCCCAGGCCCAGTTCCGTGCCCGCCTCACCCCCCAGAGCTTCCTGGACCTACCCCTG
GAGATCCAGCCGCTCACAGTTGGGGTCAACACCACCAACCCCAGCAGCCTCCTCACCCAG
ATCTGCGGCCTCCTGGGTGCTGCCCACGTCCACGGCATTGTCTTTGAGGACAACGTGGAC
ACCGAGGCGGTGGCCCAGATCCTTGACTTCATCTCCTCCCAGACCCATGTGCCCATCCTC
AGCATCAGCGGAGGCTCTGCTGTGGTCCTCACCCCCAAGGAGCCGGGCTCCGCCTTCCTG
CAGCTGGGCGTGTCCCTGGAGCAGCAGCTGCAGGTGCTGTTCAAGGTGCTGGAAGAGTAC
GACTGGAGCGCCTTCGCCGTCATCACCAGCCTGCACCCGGGCCACGCGCTCTTCCTGGAG
GGCGTGCGCGCCGTCGCCGACGCCAGCCACGTGAGTTGGCGGCTGCTGGACGTGGTCACG
CTGGAGCTGGGCCCGGGAGGGCCGCGCGCGCGCACGCAGCGCCTGCTGCGCCAGCTCGAC
GCGCCCGTGTTTGTGGCCTACTGCTCGCGCGAGGAGGCCGAGGTGCTCTTCGCCGAGGCG
GCGCAGGCCGGTCTGGTGGGGCCCGGCCACGTGTGGCTGGTGCCCAACCTGGCGCTGGGC
AGCACCGATGCGCCCCCCGCCACCTTCCCCGTGGGCCTCATCAGCGTCGTCACCGAGAGC
TGGCGCCTCAGCCTGCGCCAGAAGGTGCGCGACGGCGTGGCCATTCTGGCCCTGGGCGCC
CACAGCTACTGGCGCCAGCATGGAACCCTGCCAGCCCCGGCCGGGGACTGCCGTGTTCAC
CCTGGGCCCGTCAGCCCTGCCCGGGAGGCCTTCTACAGGCACCTACTGAATGTCACCTGG
GAGGGCCGAGACTTCTCCTTCAGCCCTGGTGGGTACCTGGTCCAGCCCACCATGGTGGTG
ATCGCCCTCAACCGGCACCGCCTCTGGGAGATGGTGGGGCGCTGGGAGCATGGCGTCCTA
TACATGAAGTACCCCGTGTGGCCTCGCTACAGTGCCTCTCTGCAGCCTGTGGTGGACAGT
CGGCACCTGACGGTGGCCACGCTGGAAGAGCGGCCCTTTGTCATCGTGGAGAGCCCTGAC
CCTGGCACAGGAGGCTGTGTCCCCAACACCGTGCCCTGCCGCAGGCAGAGCAACCACACC
TTCAGCAGCGGGGACGTGGCCCCCTACACCAAGCTCTGCTGTAAGGGATTCTGCATCGAC
ATCCTCAAGAAGCTGGCCAGAGTGGTCAAATTCTCCTACGACCTGTACCTGGTGACCAAC
GGCAAGCATGGCAAGCGGGTGCGCGGCGTATGGAACGGCATGATTGGGGAGGTGTACTAC
AAGCGGGCAGACATGGCCATCGGCTCCCTCACCATCAATGAGGAACGCTCCGAGATCGTA
GACTTCTCTGTACCCTTTGTGGAGACGGGCATCAGTGTGATGGTGGCTCGCAGCAATGGC
ACCGTCTCCCCCTCGGCCTTCTTGGAGCCATATAGCCCTGCAGTGTGGGTGATGATGTTT
GTCATGTGCCTCACTGTGGTGGCCATCACCGTCTTCATGTTCGAGTACTTCAGCCCTGTC
AGCTACAACCAGAACCTCACCAGAGGCAAGAAGTCCGGGGGCCCAGCTTTCACTATCGGC
AAGTCCGTGTGGCTGCTGTGGGCGCTGGTCTTCAACAACTCAGTGCCCATCGAGAACCCG
CGGGGCACCACCAGCAAGATCATGGTTCTGGTCTGGGCCTTCTTTGCTGTCATCTTCCTC
GCCAGCTACACGGCCAACCTGGCCGCCTTCATGATCCAAGAGCAATACATCGACACTGTG
TCGGGCCTCAGTGACAAGAAGTTTCAGCGGCCTCAAGATCAGTACCCACCTTTCCGCTTC
GGCACGGTGCCCAACGGCAGCACGGAGCGGAACATCCGCAGTAACTACCGTGACATGCAC
ACCCACATGGTCAAGTTCAACCAGCGCTCGGTGGAGGACGCGCTCACCAGCCTCAAGATG
GGGAAGCTGGATGCCTTCATCTATGATGCTGCTGTCCTCAACTACATGGCAGGCAAGGAC
GAGGGCTGCAAGCTGGTCACCATTGGGTCTGGCAAGGTCTTTGCTACCACTGGCTACGGC
ATCGCCATGCAGAAGGACTCCCACTGGAAGCGGGCCATAGACCTGGCGCTCTTGCAGTTC
CTGGGGGACGGAGAGACACAGAAACTGGAGACAGTGTGGCTCTCAGGGATCTGCCAGAAT
GAGAAGAACGAGGTGATGAGCAGCAAGCTGGACATCGACAACATGGCAGGCGTCTTCTAC
ATGCTGCTGGTGGCCATGGGGCTGGCCCTGCTGGTCTTCGCCTGGGAGCACCTGGTCTAC
TGGAAGCTGCGCCACTCGGTGCCCAACTCATCCCAGCTGGACTTCCTGCTGGCTTTCAGC
AGGGGCATCTACAGCTGCTTCAGCGGGGTGCAGAGCCTCGCCAGCCCACCGCGGCAGGCC
AGCCCGGACCTCACGGCCAGCTCGGCCCAGGCCAGCGTGCTCAAGATGCTGCAGGCAGCC
CGCGACATGGTGACCACGGCGGGCGTAAGCAGCTCCCTGGACCGCGCCACTCGCACCATC
GAGAATTGGGGTGGCGGCCGCCGTGCGCCCCCACCGTCCCCCTGCCCGACCCCGCGGTCT
GGCCCCAGCCCATGCCTGCCCACCCCCGACCCGCCCCCAGAGCCGAGCCCCACGGGCTGG
GGACCGCCAGACGGGGGTCGCGCGGCGCTTGTGCGCAGGGCTCCGCAGCCCCCGGGCCGC
CCCCCGACGCCGGGGCCGCCCCTGTCCGACGTCTCCCGAGTGTCGCGCCGCCCAGCCTGG
GAGGCGCGGTGGCCGGTGCGGACCGGGCACTGCGGGAGGCACCTCTCGGCCTCCGAGCGG
CCCCTGTCGCCCGCGCGCTGTCACTACAGCTCCTTTCCTCGAGCCGACCGATCCGGCCGC
CCCTTCCTCCCGCTCTTCCCGGAGCCCCCGGAGCTGGAGGACCTGCCGCTGCTCGGTCCG
GAGCAGCTGGCCCGGCGGGAGGCCCTGCTGCACGCGGCCTGGGCCCGGGGCTCGCGCCCG
CGTCACGCTTCCCTGCCCAGCTCCGTGGCCGAGGCCTTCGCTCGGCCCAGCTCGCTGCCC
GCTGGGTGCACCGGCCCCGCCTGCGCCCGCCCCGACGGCCACTCGGCCTGCAGGCGCTTG
GCGCAGGCGCAGTCGATGTGCTTGCCGATCTACCGGGAGGCCTGCCAGGAGGGCGAGCAG
GCAGGGGCCCCCGCCTGGCAGCACAGACAGCACGTCTGCCTGCACGCCCACGCCCACCTG
CCATTTTGCTGGGGGGCTGTCTGTCCTCACCTTCCACCCTGTGCCAGCCACGGCTCCTGG
CTCTCCGGGGCCTGGGGGCCTCTGGGGCACAGGGGCAGGACTCTGGGGCTGGGCACAGGC
TACAGAGACAGTGGGGGACTGGACGAGATCAGCAGGGTAGCCCGTGGGACGCAAGGCTTC
CCGGGACCCTGCACCTGGAGACGGATCTCCAGTCTGGAGTCAGAAGTGTGA
Protein Properties
Number of Residues 1236
Molecular Weight 134531.1
Theoretical pI 8.5
Pfam Domain Function
Signals
  • 1-19
Transmembrane Regions
  • 554-574
  • 627-647
  • 815-835
Protein Sequence
>Glutamate [NMDA] receptor subunit epsilon-3
MGGALGPALLLTSLFGAWAGLGPGQGEQGMTVAVVFSSSGPPQAQFRARLTPQSFLDLPL
EIQPLTVGVNTTNPSSLLTQICGLLGAAHVHGIVFEDNVDTEAVAQILDFISSQTHVPIL
SISGGSAVVLTPKEPGSAFLQLGVSLEQQLQVLFKVLEEYDWSAFAVITSLHPGHALFLE
GVRAVADASHVSWRLLDVVTLELGPGGPRARTQRLLRQLDAPVFVAYCSREEAEVLFAEA
AQAGLVGPGHVWLVPNLALGSTDAPPATFPVGLISVVTESWRLSLRQKVRDGVAILALGA
HSYWRQHGTLPAPAGDCRVHPGPVSPAREAFYRHLLNVTWEGRDFSFSPGGYLVQPTMVV
IALNRHRLWEMVGRWEHGVLYMKYPVWPRYSASLQPVVDSRHLTVATLEERPFVIVESPD
PGTGGCVPNTVPCRRQSNHTFSSGDVAPYTKLCCKGFCIDILKKLARVVKFSYDLYLVTN
GKHGKRVRGVWNGMIGEVYYKRADMAIGSLTINEERSEIVDFSVPFVETGISVMVARSNG
TVSPSAFLEPYSPAVWVMMFVMCLTVVAITVFMFEYFSPVSYNQNLTRGKKSGGPAFTIG
KSVWLLWALVFNNSVPIENPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEQYIDTV
SGLSDKKFQRPQDQYPPFRFGTVPNGSTERNIRSNYRDMHTHMVKFNQRSVEDALTSLKM
GKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIAMQKDSHWKRAIDLALLQF
LGDGETQKLETVWLSGICQNEKNEVMSSKLDIDNMAGVFYMLLVAMGLALLVFAWEHLVY
WKLRHSVPNSSQLDFLLAFSRGIYSCFSGVQSLASPPRQASPDLTASSAQASVLKMLQAA
RDMVTTAGVSSSLDRATRTIENWGGGRRAPPPSPCPTPRSGPSPCLPTPDPPPEPSPTGW
GPPDGGRAALVRRAPQPPGRPPTPGPPLSDVSRVSRRPAWEARWPVRTGHCGRHLSASER
PLSPARCHYSSFPRADRSGRPFLPLFPEPPELEDLPLLGPEQLARREALLHAAWARGSRP
RHASLPSSVAEAFARPSSLPAGCTGPACARPDGHSACRRLAQAQSMCLPIYREACQEGEQ
AGAPAWQHRQHVCLHAHAHLPFCWGAVCPHLPPCASHGSWLSGAWGPLGHRGRTLGLGTG
YRDSGGLDEISRVARGTQGFPGPCTWRRISSLESEV
GenBank ID Protein 187954965
UniProtKB/Swiss-Prot ID Q14957
UniProtKB/Swiss-Prot Entry Name NMDE3_HUMAN
PDB IDs Not Available
GenBank Gene ID BC140801
GeneCard ID GRIN2C
GenAtlas ID GRIN2C
HGNC ID HGNC:4587
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196 ]
  3. Lin YJ, Bovetto S, Carver JM, Giordano T: Cloning of the cDNA for the human NMDA receptor NR2C subunit and its expression in the central nervous system and periphery. Brain Res Mol Brain Res. 1996 Dec 31;43(1-2):57-64. [PubMed:9037519 ]