You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01678
Secondary Accession Numbers
  • 7015
Name Nuclear factor of activated T-cells, cytoplasmic 2
Synonyms
  1. NF-ATc2
  2. NF-ATp
  3. NFAT pre-existing subunit
  4. NFATc2
  5. T-cell transcription factor NFAT1
Gene Name NFATC2
Protein Type Unknown
Biological Properties
General Function Involved in sequence-specific DNA binding transcription factor activity
Specific Function Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2, IL-3, IL-4, TNF-alpha or GM-CSF
Pathways Not Available
Reactions Not Available
GO Classification
Component
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
Function
sequence-specific dna binding transcription factor activity
Process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
regulation of transcription, dna-dependent
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:2
Locus 20q13.2
SNPs NFATC2
Gene Sequence
>2778 bp
ATGAACGCCCCCGAGCGGCAGCCCCAACCCGACGGCGGGGACGCCCCAGGCCACGAGCCT
GGGGGCAGCCCCCAAGACGAGCTTGACTTCTCCATCCTCTTCGACTATGAGTATTTGAAT
CCGAACGAAGAAGAGCCGAATGCACATAAGGTCGCCAGCCCACCCTCCGGACCCGCATAC
CCCGATGATGTCCTGGACTATGGCCTCAAGCCATACAGCCCCCTTGCTAGTCTCTCTGGC
GAGCCCCCCGGCCGATTCGGAGAGCCGGATAGGGTAGGGCCGCAGAAGTTTCTGAGCGCG
GCCAAGCCAGCAGGGGCCTCGGGCCTGAGCCCTCGGATCGAGATCACTCCGTCCCACGAA
CTGATCCAGGCAGTGGGGCCCCTCCGCATGAGAGACGCGGGCCTCCTGGTGGAGCAGCCG
CCCCTGGCCGGGGTGGCCGCCAGCCCGAGGTTCACCCTGCCCGTGCCCGGCTTCGAGGGC
TACCGCGAGCCGCTTTGCTTGAGCCCCGCTAGCAGCGGCTCCTCTGCCAGCTTCATTTCT
GACACCTTCTCCCCCTACACCTCGCCCTGCGTCTCGCCCAATAACGGCGGGCCCGACGAC
CTGTGTCCGCAGTTTCAAAACATCCCTGCTCATTATTCCCCCAGAACCTCGCCAATAATG
TCACCTCGAACCAGCCTCGCCGAGGACAGCTGCCTGGGCCGCCACTCGCCCGTGCCCCGT
CCGGCCTCCCGCTCCTCATCGCCTGGTGCCAAGCGGAGGCATTCGTGCGCCGAGGCCTTG
GTTGCCCTGCCGCCCGGAGCCTCACCCCAGCGCTCCCGGAGCCCCTCGCCGCAGCCCTCA
TCTCACGTGGCACCCCAGGACCACGGCTCCCCGGCTGGGTACCCCCCTGTGGCTGGCTCT
GCCGTGATCATGGATGCCCTGAACAGCCTCGCCACGGACTCGCCTTGTGGGATCCCCCCC
AAGATGTGGAAGACCAGCCCTGACCCCTCGCCGGTGTCTGCCGCCCCATCCAAGGCCGGC
CTGCCTCGCCACATCTACCCGGCCGTGGAGTTCCTGGGGCCCTGCGAGCAGGGCGAGAGG
AGAAACTCGGCTCCAGAATCCATCCTGCTGGTTCCGCCCACTTGGCCCAAGCCGCTGGTG
CCTGCCATTCCCATCTGCAGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCG
CTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGCAGCCCAAGCCACATCAC
CGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCAC
CCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATT
GGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACCAGGTGCACCGAATCACG
GGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAG
ATACCCTTGGAGCCCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAG
CTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACATTGGAAGAAAGAACACG
CGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTA
CAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTT
GAAAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGCAAATGATCCTCACGGGG
CAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAA
ATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTT
GAGATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAAAAGTGAACTTCTACGTC
ATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCC
ATCAAGACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGA
GGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGGCCGAGTCCCCCTCCTGC
CTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCC
CGCTACCAGCAACAGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCC
AGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGCTGTCCCTTGCGGACGCT
CACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCC
TCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTG
CGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCGAGAATTTCGCACCAGGC
ACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTAC
CCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCG
GTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTAAACAGGAGCAGAACTTG
GACCAGACCTACTTGGATGATGTTAATGAAATTATCAGGAAGGAGTTTTCAGGACCTCCT
GCCAGAAATCAGACGTAA
Protein Properties
Number of Residues 925
Molecular Weight 100145.0
Theoretical pI 7.3
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Nuclear factor of activated T-cells, cytoplasmic 2
MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAY
PDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHE
LIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFIS
DTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPR
PASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGS
AVIMDALNSLATDSPCGIPPKMWKTSPDPSPVSAAPSKAGLPRHIYPAVEFLGPCEQGER
RNSAPESILLVPPTWPKPLVPAIPICSIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHH
RAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRIT
GKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNT
RVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTG
QNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYV
INGKRKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPTHGGLGSQPYYPQHPMVAESPSC
LVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADA
HRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPG
TTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNL
DQTYLDDVNEIIRKEFSGPPARNQT
GenBank ID Protein 56203092
UniProtKB/Swiss-Prot ID Q13469
UniProtKB/Swiss-Prot Entry Name NFAC2_HUMAN
PDB IDs
GenBank Gene ID AL035682
GeneCard ID NFATC2
GenAtlas ID NFATC2
HGNC ID HGNC:7776
References
General References
  1. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  2. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [PubMed:11780052 ]
  3. Molina H, Horn DM, Tang N, Mathivanan S, Pandey A: Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry. Proc Natl Acad Sci U S A. 2007 Feb 13;104(7):2199-204. Epub 2007 Feb 7. [PubMed:17287340 ]
  4. Brill LM, Salomon AR, Ficarro SB, Mukherji M, Stettler-Gill M, Peters EC: Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry. Anal Chem. 2004 May 15;76(10):2763-72. [PubMed:15144186 ]
  5. Luo C, Burgeon E, Carew JA, McCaffrey PG, Badalian TM, Lane WS, Hogan PG, Rao A: Recombinant NFAT1 (NFATp) is regulated by calcineurin in T cells and mediates transcription of several cytokine genes. Mol Cell Biol. 1996 Jul;16(7):3955-66. [PubMed:8668213 ]
  6. Crabtree GR: Generic signals and specific outcomes: signaling through Ca2+, calcineurin, and NF-AT. Cell. 1999 Mar 5;96(5):611-4. [PubMed:10089876 ]