You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01696
Secondary Accession Numbers
  • 7034
Name Cytokine receptor common subunit beta
Synonyms
  1. CD131 antigen
  2. CDw131
  3. GM-CSF/IL-3/IL-5 receptor common beta subunit
Gene Name CSF2RB
Protein Type Enzyme
Biological Properties
General Function Involved in cytokine receptor activity
Specific Function High affinity receptor for interleukin-3, interleukin-5 and granulocyte-macrophage colony-stimulating factor
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
receptor activity
transmembrane receptor activity
cytokine receptor activity
molecular transducer activity
signal transducer activity
Process
cytokine-mediated signaling pathway
signaling
signaling pathway
cell surface receptor linked signaling pathway
Cellular Location
  1. Membrane
  2. Single-pass type I membrane protein
Gene Properties
Chromosome Location Chromosome:2
Locus 22q13.1
SNPs CSF2RB
Gene Sequence
>2694 bp
ATGGTGCTGGCCCAGGGGCTGCTCTCCATGGCCCTGCTGGCCCTGTGCTGGGAGCGCAGC
CTGGCAGGGGCAGAAGAAACCATCCCGCTGCAGACCCTGCGCTGCTACAACGACTACACC
AGCCACATCACCTGCAGGTGGGCAGACACCCAGGATGCCCAGCGGCTCGTCAACGTGACC
CTCATTCGCCGGGTGAATGAGGACCTCCTGGAGCCAGTGTCCTGTGACCTCAGTGATGAC
ATGCCCTGGTCAGCCTGCCCCCATCCCCGCTGCGTGCCCAGGAGATGTGTCATTCCCTGC
CAGAGTTTTGTCGTCACTGACGTTGACTACTTCTCATTCCAACCAGACAGGCCTCTGGGC
ACCCGGCTCACCGTCACTCTGACCCAGCATGTCCAGCCTCCTGAGCCCAGGGACCTGCAG
ATCAGCACCGACCAGGACCACTTCCTGCTGACCTGGAGTGTGGCCCTTGGGAGTCCCCAG
AGCCACTGGTTGTCCCCAGGGGATCTGGAGTTTGAGGTGGTCTACAAGCGGCTTCAGGAC
TCTTGGGAGGACGCAGCCATCCTCCTCTCCAACACCTCCCAGGCCACCCTGGGGCCAGAG
CACCTCATGCCCAGCAGCACCTACGTGGCCCGAGTACGGACCCGCCTGGCCCCAGGTTCT
CGGCTCTCAGGACGTCCCAGCAAGTGGAGCCCAGAGGTTTGCTGGGACTCCCAGCCAGGG
GATGAGGCCCAGCCCCAGAACCTGGAGTGCTTCTTTGACGGGGCCGCCGTGCTCAGCTGC
TCCTGGGAGGTGAGGAAGGAGGTGGCCAGCTCGGTCTCCTTTGGCCTATTCTACAAGCCC
AGCCCAGATGCAGGGGAGGAAGAGTGCTCCCCAGTGCTGAGGGAGGGGCTCGGCAGCCTC
CACACCAGGCACCACTGCCAGATTCCCGTGCCCGACCCCGCGACCCACGGCCAATACATC
GTCTCTGTTCAGCCAAGGAGGGCAGAGAAACACATAAAGAGCTCAGTGAACATCCAGATG
GCCCCTCCATCCCTCAACGTGACCAAGGATGGAGACAGCTACAGCCTGCGCTGGGAAACA
ATGAAAATGCGATACGAACACATAGACCACACATTTGAGATCCAGTACAGGAAAGACACG
GCCACGTGGAAGGACAGCAAGACCGAGACCCTCCAGAACGCCCACAGCATGGCCCTGCCA
GCCCTGGAGCCCTCCACCAGGTACTGGGCCAGGGTGAGGGTCAGGACCTCCCGCACCGGC
TACAACGGGATCTGGAGCGAGTGGAGTGAGGCGCGCTCCTGGGACACCGAGTCGGTGCTG
CCTATGTGGGTGCTGGCCCTCATCGTGATCTTCCTCACCATCGCTGTGCTCCTGGCCCTC
CGCTTCTGTGGCATCTACGGGTACAGGCTGCGCAGAAAGTGGGAGGAGAAGATCCCCAAC
CCCAGCAAGAGCCACCTGTTCCAGAACGGGAGCGCAGAGCTTTGGCCCCCAGGCAGCATG
TCGGCCTTCACTAGCGGGAGTCCCCCACACCAGGGGCCGTGGGGCAGCCGCTTCCCTGAG
CTGGAGGGGGTGTTCCCTGTAGGATTCGGGGACAGCGAGGTGTCACCTCTCACCATAGAG
GACCCCAAGCATGTCTGTGATCCACCATCTGGGCCTGACACGACTCCAGCTGCCTCAGAT
CTACCCACAGAGCAGCCCCCCAGCCCCCAGCCAGGCCCGCCTGCCGCCTCCCACACACCT
GAGAAACAGGCTTCCAGCTTTGACTTCAATGGGCCCTACCTGGGGCCGCCCCACAGCCGC
TCCCTACCTGACATCCTGGGCCAGCCGGAGCCCCCACAGGAGGGTGGGAGCCAGAAGTCC
CCACCTCCAGGGTCCCTGGAGTACCTGTGTCTGCCTGCTGGGGGGCAGGTGCAACTGGTC
CCTCTGGCCCAGGCGATGGGACCGGGACAGGCCGTGGAAGTGGAGAGAAGGCCGAGCCAG
GGGGCTGCAGGGAGTCCCTCCCTGGAGTCCGGGGGAGGCCCTGCCCCTCCTGCTCTTGGG
CCAAGGGTGGGAGGACAGGACCAAAAGGACAGCCCTGTGGCTATACCCATGAGCTCTGGG
GACACTGAGGACCCTGGAGTGGCCTCTGGTTATGTCTCCTCTGCAGACCTGGTATTCACC
CCAAACTCAGGGGCCTCGTCTGTCTCCCTAGTTCCCTCTCTGGGCCTCCCCTCAGACCAG
ACCCCCAGCTTATGTCCTGGGCTGGCCAGTGGACCCCCTGGAGCCCCAGGCCCTGTGAAG
TCAGGGTTTGAGGGCTATGTGGAGCTCCCTCCAATTGAGGGCCGGTCCCCCAGGTCACCA
AGGAACAATCCTGTCCCCCCTGAGGCCAAAAGCCCTGTCCTGAACCCAGGGGAACGCCCG
GCAGATGTGTCCCCAACATCCCCACAGCCCGAGGGCCTCCTTGTCCTGCAGCAAGTGGGC
GACTATTGCTTCCTCCCCGGCCTGGGGCCCGGCCCTCTCTCGCTCCGGAGTAAACCTTCT
TCCCCGGGACCCGGTCCTGAGATCAAGAACCTAGACCAGGCTTTTCAAGTCAAGAAGCCC
CCAGGCCAGGCTGTGCCCCAGGTGCCCGTCATTCAGCTCTTCAAAGCCCTGAAGCAGCAG
GACTACCTGTCTCTGCCCCCTTGGGAGGTCAACAAGCCTGGGGAGGTGTGTTGA
Protein Properties
Number of Residues 897
Molecular Weight 97334.9
Theoretical pI 5.21
Pfam Domain Function
Signals
  • 1-16
Transmembrane Regions
  • 444-460
Protein Sequence
>Cytokine receptor common subunit beta
MVLAQGLLSMALLALCWERSLAGAEETIPLQTLRCYNDYTSHITCRWADTQDAQRLVNVT
LIRRVNEDLLEPVSCDLSDDMPWSACPHPRCVPRRCVIPCQSFVVTDVDYFSFQPDRPLG
TRLTVTLTQHVQPPEPRDLQISTDQDHFLLTWSVALGSPQSHWLSPGDLEFEVVYKRLQD
SWEDAAILLSNTSQATLGPEHLMPSSTYVARVRTRLAPGSRLSGRPSKWSPEVCWDSQPG
DEAQPQNLECFFDGAAVLSCSWEVRKEVASSVSFGLFYKPSPDAGEEECSPVLREGLGSL
HTRHHCQIPVPDPATHGQYIVSVQPRRAEKHIKSSVNIQMAPPSLNVTKDGDSYSLRWET
MKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTG
YNGIWSEWSEARSWDTESVLPMWVLALIVIFLTIAVLLALRFCGIYGYRLRRKWEEKIPN
PSKSHLFQNGSAELWPPGSMSAFTSGSPPHQGPWGSRFPELEGVFPVGFGDSEVSPLTIE
DPKHVCDPPSGPDTTPAASDLPTEQPPSPQPGPPAASHTPEKQASSFDFNGPYLGPPHSR
SLPDILGQPEPPQEGGSQKSPPPGSLEYLCLPAGGQVQLVPLAQAMGPGQAVEVERRPSQ
GAAGSPSLESGGGPAPPALGPRVGGQDQKDSPVAIPMSSGDTEDPGVASGYVSSADLVFT
PNSGASSVSLVPSLGLPSDQTPSLCPGLASGPPGAPGPVKSGFEGYVELPPIEGRSPRSP
RNNPVPPEAKSPVLNPGERPADVSPTSPQPEGLLVLQQVGDYCFLPGLGPGPLSLRSKPS
SPGPGPEIKNLDQAFQVKKPPGQAVPQVPVIQLFKALKQQDYLSLPPWEVNKPGEVC
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P32927
UniProtKB/Swiss-Prot Entry Name IL3RB_HUMAN
PDB IDs
GenBank Gene ID M59941
GeneCard ID CSF2RB
GenAtlas ID CSF2RB
HGNC ID HGNC:2436
References
General References
  1. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  2. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [PubMed:15461802 ]
  3. Hayashida K, Kitamura T, Gorman DM, Arai K, Yokota T, Miyajima A: Molecular cloning of a second subunit of the receptor for human granulocyte-macrophage colony-stimulating factor (GM-CSF): reconstitution of a high-affinity GM-CSF receptor. Proc Natl Acad Sci U S A. 1990 Dec;87(24):9655-9. [PubMed:1702217 ]
  4. Mulhern TD, Lopez AF, D'Andrea RJ, Gaunt C, Vandeleur L, Vadas MA, Booker GW, Bagley CJ: The solution structure of the cytokine-binding domain of the common beta-chain of the receptors for granulocyte-macrophage colony-stimulating factor, interleukin-3 and interleukin-5. J Mol Biol. 2000 Apr 7;297(4):989-1001. [PubMed:10736232 ]
  5. Rossjohn J, McKinstry WJ, Woodcock JM, McClure BJ, Hercus TR, Parker MW, Lopez AF, Bagley CJ: Structure of the activation domain of the GM-CSF/IL-3/IL-5 receptor common beta-chain bound to an antagonist. Blood. 2000 Apr 15;95(8):2491-8. [PubMed:10753826 ]
  6. Carr PD, Gustin SE, Church AP, Murphy JM, Ford SC, Mann DA, Woltring DM, Walker I, Ollis DL, Young IG: Structure of the complete extracellular domain of the common beta subunit of the human GM-CSF, IL-3, and IL-5 receptors reveals a novel dimer configuration. Cell. 2001 Jan 26;104(2):291-300. [PubMed:11207369 ]
  7. Carr PD, Conlan F, Ford S, Ollis DL, Young IG: An improved resolution structure of the human beta common receptor involved in IL-3, IL-5 and GM-CSF signalling which gives better definition of the high-affinity binding epitope. Acta Crystallogr Sect F Struct Biol Cryst Commun. 2006 Jun 1;62(Pt 6):509-13. Epub 2006 May 31. [PubMed:16754968 ]
  8. Dirksen U, Nishinakamura R, Groneck P, Hattenhorst U, Nogee L, Murray R, Burdach S: Human pulmonary alveolar proteinosis associated with a defect in GM-CSF/IL-3/IL-5 receptor common beta chain expression. J Clin Invest. 1997 Nov 1;100(9):2211-7. [PubMed:9410898 ]