You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01723
Secondary Accession Numbers
  • 7067
Name Vasopressin V1a receptor
Synonyms
  1. AVPR V1a
  2. Antidiuretic hormone receptor 1a
  3. V1aR
  4. Vascular/hepatic-type arginine vasopressin receptor
Gene Name AVPR1A
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl- inositol-calcium second messenger system. Has been involved in social behaviors, including affiliation and attachment
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
receptor activity
vasopressin receptor activity
molecular transducer activity
signal transducer activity
peptide receptor activity
peptide receptor activity, g-protein coupled
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 12q14-q15
SNPs AVPR1A
Gene Sequence
>1257 bp
ATGCGTCTCTCCGCCGGTCCCGACGCGGGGCCCTCGGGCAACTCCAGCCCATGGTGGCCT
CTGGCCACCGGCGCTGGCAACACAAGCCGGGAGGCCGAAGCCCTCGGGGAGGGCAACGGC
CCACCGAGGGACGTGCGCAACGAGGAGCTGGCCAAACTGGAGATCGCCGTGCTGGCGGTG
ACTTTCGCGGTGGCCGTGCTGGGCAACAGCAGCGTACTGCTGGCTCTGCACCGGACGCCG
CGCAAGACGTCCCGCATGCACCTCTTCATCCGACACCTCAGCCTGGCCGACCTGGCCGTG
GCATTCTTCCAGGTGCTGCCGCAAATGTGCTGGGACATCACCTACCGCTTCCGCGGCCCC
GACTGGCTGTGCCGCGTGGTGAAGCACCTGCAGGTGTTCGGCATGTTTGCGTCGGCCTAC
ATGCTGGTAGTCATGACAGCCGACCGCTACATCGCGGTGTGCCACCCGCTCAAGACTCTG
CAACAGCCCGCGCGCCGCTCGCGCCTCATGATCGCGGCCGCCTGGGTGCTGAGCTTCGTG
CTGAGCACGCCGCAGTACTTCGTCTTCTCCATGATCGAGGTGAACAATGTCACCAAGGCC
CGCGACTGCTGGGCCACCTTCATCCAGCCCTGGGGTTCTCGTGCCTACGTGACCTGGATG
ACGGGCGGCATCTTTGTGGCGCCCGTGGTCATCTTGGGTACCTGCTACGGCTTCATCTGC
TACAACATCTGGTGCAACGTCCGCGGGAAGACGGCGTCGCGCCAGAGCAAGGGTGCAGAG
CAAGCGGGTGTGGCCTTCCAAAAGGGGTTCCTGCTCGCACCCTGTGTCAGCAGCGTGAAG
TCCATTTCCCGGGCCAAGATCCGCACGGTGAAGATGACTTTTGTGATCGTGACGGCTTAC
ATCGTCTGCTGGGCGCCTTTCTTCATCATCCAGATGTGGTCTGTCTGGGATCCCATGTCC
GTCTGGACCGAATCGGAAAACCCTACCATCACCATCACTGCATTACTGGGTTCCTTGAAT
AGCTGCTGTAATCCCTGGATATACATGTTTTTTAGTGGCCATCTCCTTCAAGACTGTGTT
CAAAGCTTCCCATGCTGCCAAAACATGAAGGAAAAATTCAACAAAGAAGATACTGACAGT
ATGAGCAGAAGACAGACTTTTTATTCTAACAATCGAAGCCCAACAAACAGTACGGGTATG
TGGAAGGACTCGCCTAAATCTTCCAAGTCCATCAAATTCATTCCTGTTTCAACTTGA
Protein Properties
Number of Residues 418
Molecular Weight 46799.1
Theoretical pI 9.67
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 53-76
  • 89-110
  • 126-147
  • 169-190
  • 219-239
  • 294-313
  • 332-351
Protein Sequence
>Vasopressin V1a receptor
MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAKLEIAVLAV
TFAVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQMCWDITYRFRGP
DWLCRVVKHLQVFGMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIAAAWVLSFV
LSTPQYFVFSMIEVNNVTKARDCWATFIQPWGSRAYVTWMTGGIFVAPVVILGTCYGFIC
YNIWCNVRGKTASRQSKGAEQAGVAFQKGFLLAPCVSSVKSISRAKIRTVKMTFVIVTAY
IVCWAPFFIIQMWSVWDPMSVWTESENPTITITALLGSLNSCCNPWIYMFFSGHLLQDCV
QSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKFIPVST
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P37288
UniProtKB/Swiss-Prot Entry Name V1AR_HUMAN
PDB IDs
GenBank Gene ID L25615
GeneCard ID AVPR1A
GenAtlas ID AVPR1A
HGNC ID HGNC:895
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Thibonnier M, Auzan C, Madhun Z, Wilkins P, Berti-Mattera L, Clauser E: Molecular cloning, sequencing, and functional expression of a cDNA encoding the human V1a vasopressin receptor. J Biol Chem. 1994 Feb 4;269(5):3304-10. [PubMed:8106369 ]
  3. Hirasawa A, Shibata K, Kotosai K, Tsujimoto G: Cloning, functional expression and tissue distribution of human cDNA for the vascular-type vasopressin receptor. Biochem Biophys Res Commun. 1994 Aug 30;203(1):72-9. [PubMed:8074728 ]
  4. North WG, Fay MJ, Longo K, Du J: Functional vasopressin V1 type receptors are present in variant as well as classical forms of small-cell carcinoma. Peptides. 1997;18(7):985-93. [PubMed:9357056 ]
  5. North WG, Fay MJ, Longo KA, Du J: Expression of all known vasopressin receptor subtypes by small cell tumors implies a multifaceted role for this neuropeptide. Cancer Res. 1998 May 1;58(9):1866-71. [PubMed:9581826 ]
  6. Kim SJ, Young LJ, Gonen D, Veenstra-VanderWeele J, Courchesne R, Courchesne E, Lord C, Leventhal BL, Cook EH Jr, Insel TR: Transmission disequilibrium testing of arginine vasopressin receptor 1A (AVPR1A) polymorphisms in autism. Mol Psychiatry. 2002;7(5):503-7. [PubMed:12082568 ]
  7. Adikesavan NV, Mahmood SS, Stanley N, Xu Z, Wu N, Thibonnier M, Shoham M: A C-terminal segment of the V1R vasopressin receptor is unstructured in the crystal structure of its chimera with the maltose-binding protein. Acta Crystallogr Sect F Struct Biol Cryst Commun. 2005 Apr 1;61(Pt 4):341-5. Epub 2005 Mar 24. [PubMed:16511036 ]