You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01735
Secondary Accession Numbers
  • 7084
Name Transcobalamin-2
Synonyms
  1. TC II
  2. TC-2
  3. TCII
  4. Transcobalamin II
Gene Name TCN2
Protein Type Transporter
Biological Properties
General Function Involved in cobalamin binding
Specific Function Primary vitamin B12-binding and transport protein. Delivers cobalamin to cells
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
cobalamin binding
vitamin binding
Process
establishment of localization
transport
vitamin transport
cobalamin transport
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:2
Locus 22q12.2
SNPs TCN2
Gene Sequence
>1284 bp
ATGAGGCACCTTGGGGCCTTCCTCTTCCTTCTGGGGGTCCTGGGGGCCCTCACTGAGATG
TGTGAAATACCAGAGATGGACAGCCATCTGGTAGAGAAGTTGGGCCAGCACCTCTTACCT
TGGATGGACCGGCTTTCCCTGGAGCACTTGAACCCCAGCATCTATGTGGGCCTACGCCTC
TCCAGTCTGCAGGCTGGGACCAAGGAAGACCTCTACCTGCACAGCCTCAAGCTTGGTTAC
CAGCAGTGCCTCCTAGGGTCTGCCTTCAGCGAGGATGACGGTGACTGCCAGGGCAAGCCT
TCCATGGGCCAGCTGGCCCTCTACCTGCTCGCTCTCAGAGCCAACTGTGAGTTTGTCAGG
GGCCACAAGGGGGACAGGCTGGTCTCACAGCTCAAATGGTTCCTGGAGGATGAGAAGAGA
GCCATTGGGCATGATCACAAGGGCCACCCCCACACTAGCTACTACCAGTATGGCCTGGGC
ATTCTGGCCCTGTGTCTCCACCAGAAGCGGGTCCATGACAGCGTGGTGGACAAACTTCTG
TATGCTGTGGAACCTTTCCACCAGGGCCACCATTCTGTGGACACAGCAGCCATGGCAGGC
TTGGCATTCACCTGTCTGAAGCGCTCAAACTTCAACCCTGGTCGGAGACAACGGATCACC
ATGGCCATCAGAACAGTGCGAGAGGAGATCTTGAAGGCCCAGACCCCCGAGGGCCACTTT
GGGAATGTCTACAGCACCCCATTGGCATTACAGTTCCTCATGACTTCCCCCATGCCTGGG
GCAGAACTGGGAACAGCATGTCTCAAGGCGAGGGTTGCTTTGCTGGCCAGTCTGCAGGAT
GGAGCCTTCCAGAATGCTCTCATGATTTCCCAGCTGCTGCCCGTTCTGAACCACAAGACC
TACATTGATCTGATCTTCCCAGACTGTCTGGCACCACGAGTCATGTTGGAACCAGCTGCT
GAGACCATTCCTCAGACCCAAGAGATCATCAGTGTCACGCTGCAGGTGCTTAGTCTCTTG
CCGCCGTACAGACAGTCCATCTCTGTTCTGGCCGGGTCCACCGTGGAAGATGTCCTGAAG
AAGGCCCATGAGTTAGGAGGATTCACATATGAAACACAGGCCTCCTCGTCAGGCCCCTAC
TTAACCTCCGTGATGGGGAAAGCGGCCGGAGAAAGGGAGTTCTGGCAGCTTCTCCGAGAC
CCCAACACCCCACTGTTGCAAGGTATTGCTGACTACAGACCCAAGGATGGAGAAACCATT
GAGCTGAGGCTGGTTAGCTGGTAG
Protein Properties
Number of Residues 427
Molecular Weight 47534.5
Theoretical pI 7.01
Pfam Domain Function
Signals
  • 1-18
Transmembrane Regions
  • None
Protein Sequence
>Transcobalamin-2
MRHLGAFLFLLGVLGALTEMCEIPEMDSHLVEKLGQHLLPWMDRLSLEHLNPSIYVGLRL
SSLQAGTKEDLYLHSLKLGYQQCLLGSAFSEDDGDCQGKPSMGQLALYLLALRANCEFVR
GHKGDRLVSQLKWFLEDEKRAIGHDHKGHPHTSYYQYGLGILALCLHQKRVHDSVVDKLL
YAVEPFHQGHHSVDTAAMAGLAFTCLKRSNFNPGRRQRITMAIRTVREEILKAQTPEGHF
GNVYSTPLALQFLMTSPMRGAELGTACLKARVALLASLQDGAFQNALMISQLLPVLNHKT
YIDLIFPDCLAPRVMLEPAAETIPQTQEIISVTLQVLSLLPPYRQSISVLAGSTVEDVLK
KAHELGGFTYETQASLSGPYLTSVMGKAAGEREFWQLLRDPNTPLLQGIADYRPKDGETI
ELRLVSW
GenBank ID Protein 339196
UniProtKB/Swiss-Prot ID P20062
UniProtKB/Swiss-Prot Entry Name TCO2_HUMAN
PDB IDs Not Available
GenBank Gene ID M60396
GeneCard ID TCN2
GenAtlas ID TCN2
HGNC ID HGNC:11653
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  3. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [PubMed:15461802 ]
  4. Platica O, Janeczko R, Quadros EV, Regec A, Romain R, Rothenberg SP: The cDNA sequence and the deduced amino acid sequence of human transcobalamin II show homology with rat intrinsic factor and human transcobalamin I. J Biol Chem. 1991 Apr 25;266(12):7860-3. [PubMed:1708393 ]
  5. Li N, Seetharam S, Lindemans J, Alpers DH, Arwert F, Seetharam B: Isolation and sequence analysis of variant forms of human transcobalamin II. Biochim Biophys Acta. 1993 Feb 20;1172(1-2):21-30. [PubMed:8439564 ]
  6. Regec A, Quadros EV, Platica O, Rothenberg SP: The cloning and characterization of the human transcobalamin II gene. Blood. 1995 May 15;85(10):2711-9. [PubMed:7742531 ]
  7. Quadros EV, Rothenberg SP, Pan YC, Stein S: Purification and molecular characterization of human transcobalamin II. J Biol Chem. 1986 Nov 25;261(33):15455-60. [PubMed:3782074 ]
  8. Quadros EV, Sai P, Rothenberg SP: Functional human transcobalamin II isoproteins are secreted by insect cells using the baculovirus expression system. Blood. 1993 Mar 1;81(5):1239-45. [PubMed:8443384 ]
  9. Namour F, Olivier J, Abdelmouttaleb I, Adjalla C, Debard R, Salvat C, Gueant J: Transcobalamin codon 259 polymorphism in HT-29 and Caco-2 cells and in Caucasians: relation to transcobalamin and homocysteine concentration in blood. Blood. 2001 Feb 15;97(4):1092-8. [PubMed:11159542 ]