You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01822
Secondary Accession Numbers
  • 7183
Name Geranylgeranyl transferase type-1 subunit beta
Synonyms
  1. GGTase-I-beta
  2. Geranylgeranyl transferase type I subunit beta
  3. Type I protein geranyl-geranyltransferase subunit beta
Gene Name PGGT1B
Protein Type Unknown
Biological Properties
General Function Involved in CAAX-protein geranylgeranyltransferase acti
Specific Function Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to a cysteine at the fourth position from the C-terminus of proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X. Acts on the Rac1, Rac2, Rap1A and Rap1B proteins. The beta subunit is responsible for peptide-binding.
Pathways Not Available
Reactions
Geranylgeranyl-PP + protein-cysteine → S-geranylgeranyl-protein + Pyrophosphate details
GO Classification
Biological Process
protein geranylgeranylation
positive regulation of cell cycle
positive regulation of cell proliferation
response to cytokine stimulus
Cellular Component
CAAX-protein geranylgeranyltransferase complex
Function
catalytic activity
Molecular Function
isoprenoid binding
metal ion binding
peptide binding
zinc ion binding
drug binding
CAAX-protein geranylgeranyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus 5q22.3
SNPs PGGT1B
Gene Sequence
>1134 bp
ATGGCGGCCACTGAGGATGAGAGGCTAGCAGGGAGCGGTGAGGGAGAGCGGCTGGATTTC
TTACGGGATCGGCACGTGCGATTTTTCCAGCGCTGCCTCCAGGTTTTGCCGGAGCGCTAT
TCTTCACTCGAGACAAGCAGGTTGACAATTGCATTTTTTGCACTCTCCGGGCTGGATATG
TTGGATTCCTTAGATGTGGTGAACAAAGATGATATAATAGAGTGGATTTATTCCCTGCAG
GTCCTTCCCACAGAAGACAGATCAAATCTAAATCGCTGTGGTTTCCGAGGCTCTTCATAC
CTGGGTATTCCGTTCAATCCATCAAAGGCTCCTGGAACAGCTCATCCTTATGATAGTGGC
CACATTGCAATGACCTACACTGGCCTCTCATGCTTAGTTATTCTTGGAGACGACTTAAGC
CGAGTAAATAAAGAAGCTTGCTTAGCGGGCTTGAGAGCCCTTCAGCTGGAAGATGGGAGT
TTTTGTGCAGTACCTGAAGGCAGTGAAAATGACATGCGATTTGTGTACTGTGCTTCCTGT
ATTTGCTATATGCTCAACAACTGGTCAGGCATGGATATGAAAAAAGCCATCACCTATATT
AGAAGGAGTATGTCCTATGACAATGGACTGGCACAGGGAGCTGGACTTGAATCTCATGGA
GGATCAACTTTTTGTGGCATTGCCTCACTATGTCTGATGGGTAAACTAGAAGAAGTTTTT
TCAGAAAAAGAATTGAACAGGATAAAGAGGTGGTGTATAATGAGGCAACAAAATGGTTAT
CATGGAAGACCTAATAAGCCTGTAGACACCTGTTATTCTTTTTGGGTGGGAGCAACTCTG
AAGCTTCTAAAAATTTTCCAATACACTAACTTTGAGAAAAATAGAAATTACATCTTATCA
ACTCAAGATCGCCTTGTAGGGGGATTTGCCAAGTGGCCAGACAGTCATCCAGATGCTTTG
CATGCATACTTTGGGATCTGTGGCCTGTCACTAATGGAGGAAAGTGGAATTTGTAAAGTT
CATCCTGCTCTGAATGTAAGCACACGGACTTCTGAACGCCTTCTAGATCTCCATCAAAGC
TGGAAAACCAAGGACTCTAAACAATGCTCAGAGAATGTACATATCTCCACATGA
Protein Properties
Number of Residues 377
Molecular Weight 42367.81
Theoretical pI 6.822
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Geranylgeranyl transferase type-1 subunit beta
MAATEDERLAGSGEGERLDFLRDRHVRFFQRCLQVLPERYSSLETSRLTIAFFALSGLDM
LDSLDVVNKDDIIEWIYSLQVLPTEDRSNLNRCGFRGSSYLGIPFNPSKAPGTAHPYDSG
HIAMTYTGLSCLVILGDDLSRVNKEACLAGLRALQLEDGSFCAVPEGSENDMRFVYCASC
ICYMLNNWSGMDMKKAITYIRRSMSYDNGLAQGAGLESHGGSTFCGIASLCLMGKLEEVF
SEKELNRIKRWCIMRQQNGYHGRPNKPVDTCYSFWVGATLKLLKIFQYTNFEKNRNYILS
TQDRLVGGFAKWPDSHPDALHAYFGICGLSLMEESGICKVHPALNVSTRTSERLLDLHQS
WKTKDSKQCSENVHIST
GenBank ID Protein 167860116
UniProtKB/Swiss-Prot ID P53609
UniProtKB/Swiss-Prot Entry Name PGTB1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_005023.3
GeneCard ID PGGT1B
GenAtlas ID Not Available
HGNC ID HGNC:8895
References
General References
  1. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. [PubMed:15372022 ]
  2. Zhang FL, Diehl RE, Kohl NE, Gibbs JB, Giros B, Casey PJ, Omer CA: cDNA cloning and expression of rat and human protein geranylgeranyltransferase type-I. J Biol Chem. 1994 Feb 4;269(5):3175-80. [PubMed:8106351 ]