You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01826
Secondary Accession Numbers
  • 7187
Name Vasopressin V1b receptor
Synonyms
  1. AVPR V1b
  2. AVPR V3
  3. Antidiuretic hormone receptor 1b
  4. V1bR
  5. Vasopressin V3 receptor
Gene Name AVPR1B
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl- inositol-calcium second messenger system
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
receptor activity
vasopressin receptor activity
molecular transducer activity
signal transducer activity
peptide receptor activity
peptide receptor activity, g-protein coupled
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 1q32
SNPs AVPR1B
Gene Sequence
>1275 bp
ATGGATTCTGGGCCTCTGTGGGATGCCAACCCCACCCCTCGGGGCACCCTCTCTGCCCCC
AATGCCACAACACCCTGGCTGGGCCGGGATGAGGAGCTGGCCAAGGTGGAGATCGGAGTC
CTGGCCACTGTCCTGGTGCTGGCGACCGGGGGCAACCTGGCTGTGCTGCTGACCCTGGGC
CAGCTGGGCCGCAAGCGCTCCCGCATGCACCTGTTCGTGCTGCACTTAGCCCTGACAGAC
CTGGCCGTGGCGCTCTTCCAGGTGCTGCCACAGCTGCTGTGGGACATCACCTACCGCTTC
CAGGGCCCCGACCTCCTGTGCAGGGCCGTCAAGTACCTGCAGGTGCTCAGCATGTTTGCC
TCCACCTACATGCTGCTGGCCATGACGCTGGACCGCTACCTGGCTGTCTGTCACCCCCTG
CGCAGCCTCCAGCAGCCAGGCCAGTCCACCTACCTGCTCATCGCTGCTCCCTGGCTGCTG
GCCGCCATCTTCAGCCTCCCTCAAGTCTTCATTTTTTCCCTGCGGGAGGTGATCCAGGGC
TCAGGGGTGCTGGACTGCTGGGCAGACTTCGGCTTCCCTTGGGGGCCACGGGCCTACCTC
ACCTGGACCACCCTGGCTATCTTCGTTCTGCCGGTGACCATGCTCACGGCCTGCTACAGC
CTCATCTGCCATGAGATCTGTAAAAACCTAAAAGTCAAGACACAGGCCTGGCGGGTGGGA
GGAGGGGGCTGGAGGACTTGGGACAGGCCCTCACCTTCCACCTTAGCTGCCACCACTCGG
GGGCTGCCATCTCGGGTCAGCAGCATCAACACCATCTCACGGGCCAAGATCCGAACAGTG
AAGATGACCTTTGTCATCGTGCTGGCCTACATCGCTTGCTGGGCTCCCTTCTTCAGTGTC
CAGATGTGGTCCGTGTGGGACAAGAATGCCCCTGATGAAGATTCCACCAATGTGGCTTTC
ACCATCTCTATGCTTTTGGGCAACCTCAACAGCTGCTGCAACCCCTGGATCTACATGGGC
TTCAACAGCCACCTGTTACCGCGGCCCCTGCGTCACCTTGCCTGCTGTGGGGGTCCCCAG
CCCAGGATGCGCCGGCGGCTCTCCGACGGCAGCCTCTCGAGCCGCCACACCACGCTGCTG
ACCCGCTCCAGCTGCCCGGCCACCCTCAGCCTCAGCCTCAGCCTAACCCTCAGTGGGAGG
CCCAGGCCTGAAGAGTCACCAAGGGACTTGGAGCTGGCAGATGGGGAAGGCACCGCTGAG
ACCATCATCTTTTAG
Protein Properties
Number of Residues 424
Molecular Weight 46970.3
Theoretical pI 9.05
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 36-59
  • 72-93
  • 109-130
  • 152-173
  • 202-222
  • 284-303
  • 322-341
Protein Sequence
>Vasopressin V1b receptor
MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLG
QLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFA
STYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQG
SGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVG
GGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSV
QMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPLRHLACCGGPQ
PRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAE
TIIF
GenBank ID Protein 2613125
UniProtKB/Swiss-Prot ID P47901
UniProtKB/Swiss-Prot Entry Name V1BR_HUMAN
PDB IDs Not Available
GenBank Gene ID AF030512
GeneCard ID AVPR1B
GenAtlas ID AVPR1B
HGNC ID HGNC:896
References
General References
  1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  2. North WG, Fay MJ, Longo K, Du J: Functional vasopressin V1 type receptors are present in variant as well as classical forms of small-cell carcinoma. Peptides. 1997;18(7):985-93. [PubMed:9357056 ]
  3. North WG, Fay MJ, Longo KA, Du J: Expression of all known vasopressin receptor subtypes by small cell tumors implies a multifaceted role for this neuropeptide. Cancer Res. 1998 May 1;58(9):1866-71. [PubMed:9581826 ]
  4. Sugimoto T, Saito M, Mochizuki S, Watanabe Y, Hashimoto S, Kawashima H: Molecular cloning and functional expression of a cDNA encoding the human V1b vasopressin receptor. J Biol Chem. 1994 Oct 28;269(43):27088-92. [PubMed:7929452 ]
  5. de Keyzer Y, Auzan C, Lenne F, Beldjord C, Thibonnier M, Bertagna X, Clauser E: Cloning and characterization of the human V3 pituitary vasopressin receptor. FEBS Lett. 1994 Dec 19;356(2-3):215-20. [PubMed:7805841 ]
  6. Rene P, Lenne F, Ventura MA, Bertagna X, de Keyzer Y: Nucleotide sequence and structural organization of the human vasopressin pituitary receptor (V3) gene. Gene. 2000 Jan 4;241(1):57-64. [PubMed:10607899 ]
  7. Dempster EL, Burcescu I, Wigg K, Kiss E, Baji I, Gadoros J, Tamas Z, Kennedy JL, Vetro A, Kovacs M, Barr CL: Evidence of an association between the vasopressin V1b receptor gene (AVPR1B) and childhood-onset mood disorders. Arch Gen Psychiatry. 2007 Oct;64(10):1189-95. [PubMed:17909131 ]