You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01851
Secondary Accession Numbers
  • 7222
  • HMDBP04458
Name 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2
Synonyms
  1. PLC-L4
  2. PLC-eta2
  3. Phosphoinositide phospholipase C-eta-2
  4. Phosphoinositide phospholipase C-like 4
  5. Phospholipase C-eta-2
  6. Phospholipase C-like protein 4
Gene Name PLCH2
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. This phospholipase activity is very sensitive to calcium. May be important for formation and maintenance of the neuronal network in the postnatal brain (By similarity).
Pathways Not Available
Reactions
1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + Water → Inositol 1,4,5-trisphosphate + DG(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) details
GO Classification
Biological Process
lipid catabolic process
phosphatidylinositol metabolic process
intracellular signal transduction
Cellular Component
cytoplasm
plasma membrane
Function
ion binding
cation binding
metal ion binding
hydrolase activity, acting on ester bonds
binding
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphoric diester hydrolase activity
phospholipase c activity
phosphoinositide phospholipase c activity
calcium ion binding
lipase activity
phospholipase activity
Molecular Function
phospholipid binding
phosphatidylinositol phospholipase C activity
signal transducer activity
calcium ion binding
Process
metabolic process
primary metabolic process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
lipid metabolic process
intracellular signaling pathway
signaling
signaling pathway
Cellular Location
  1. Cell membrane
  2. Cytoplasm
Gene Properties
Chromosome Location 1
Locus 1p36.32
SNPs PLCH2
Gene Sequence
>4251 bp
ATGTCTGGTCCATGGCCCTCCCCCGACAGCCGGACCAAGGGAACGGTGGCCTGGCTGGCG
GAGGTACTCCTCTGGGTTGGAGGGAGTGTGGTGCTGTCTTCAGAGTGGCAGCTCGGCCCC
CTGGTGGAGCGGTGCATGGGTGCCATGCAAGAGGGGATGCAGATGGTGAAGCTGCGTGGC
GGCTCCAAGGGCCTGGTCCGCTTCTACTACCTGGACGAGCACCGCTCCTGCATCCGCTGG
AGGCCCTCACGCAAGAACGAGAAGGCCAAGATCTCCATCGACTCCATCCAGGAGGTGAGT
GAGGGGCGGCAGTCGGAGGTCTTCCAGCGCTACCCTGACGGCAGCTTCGACCCCAACTGC
TGCTTCAGCATCTACCACGGCAGCCACCGCGAGTCGCTGGACCTGGTCTCCACCAGCAGC
GAGGTGGCGCGCACCTGGGTCACTGGCCTGCGCTACCTCATGGCCGGCATCAGCGACGAG
GACAGCCTGGCTCGCCGCCAGCGCACCAGGGACCAGTGGCTGAAGCAGACGTTTGACGAG
GCCGACAAGAACGGGGATGGCAGCCTGAGCATTGGCGAGGTCCTGCAGCTGCTGCACAAG
CTCAACGTGAACCTGCCCCGGCAGAGGGTGAAGCAGATGTTCAGGGAAGCGGACACGGAT
GACCACCAAGGGACGCTGGGTTTTGAAGAGTTCTGTGCCTTCTACAAGATGATGTCCACC
CGCCGGGACCTCTACCTGCTCATGCTGACCTACAGCAACCACAAGGACCACCTGGATGCC
GCCAGCCTGCAGCGCTTCCTGCAGGTGGAGCAGAAGATGGCGGGTGTGACCCTCGAGAGC
TGCCAGGACATCATCGAGCAGTTTGAGCCATGCCCAGAAAACAAGAGTAAGGGGCTGCTG
GGCATTGATGGCTTCACCAACTACACCAGGAGCCCTGCTGGTGACATCTTCAACCCTGAG
CACCACCATGTGCACCAGGACATGACGCAGCCGCTGAGCCACTACTTCATCACCTCGTCC
CACAACACCTACCTCGTGGGTGACCAGCTCATGTCCCAGTCACGGGTGGACATGTATGCT
TGGGTCCTGCAGGCTGGCTGCCGCTGCGTGGAGGTGGACTGCTGGGATGGGCCCGACGGG
GAGCCCATTGTGCACCATGGCTACACTCTGACTTCCAAGATCCTCTTCAAAGACGTCATT
GAAACCATCAACAAATATGCCTTCATCAAGAATGAGTACCCAGTGATCCTGTCCATCGAA
AACCACTGCAGTGTCATCCAGCAGAAGAAAATGGCCCAGTATCTGACTGACATCCTTGGG
GACAAGCTGGACCTGTCATCAGTGAGCAGTGAAGATGCCACCACACTCCCCTCTCCACAG
ATGCTCAAGGGCAAGATCCTCGTGAAGGGGAAGAAGCTCCCAGCCAACATCAGCGAGGAT
GCGGAGGAAGGCGAGGTGTCTGATGAGGACAGTGCTGATGAGATTGACGATGACTGCAAG
CTCCTCAATGGGGATGCATCCACCAATCGAAAGCGTGTAGAAAACACTGCTAAGAGGAAA
CTGGATTCCCTCATCAAAGAGTCGAAGATTCGGGACTGTGAGGACCCCAACAACTTCTCC
GTCTCCACACTGTCCCCATCTGGAAAGCTCGGACGCAAGAGCAAGGCTGAAGAGGACGTG
GAGTCTGGGGAGGATGCCGGGGCCAGCAGACGCAATGGCCGCCTCGTCGTGGGAAGCTTC
TCCAGGCGCAAGAAGAAGGGCAGCAAGCTGAAGAAGGCGGCCAGCGTGGAGGAGGGAGAT
GAGGGTCAGGACTCCCCGGGAGGCCAGAGCCGAGGGGCGACCCGGCAGAAGAAGACCATG
AAGCTGTCCCGGGCCCTCTCTGACCTGGTGAAGTACACCAAGTCCGTGGCCACCCACGAC
ATAGAGATGGAGGCGGCGTCCAGCTGGCAGGTGTCGTCCTTCAGCGAGACCAAGGCCCAC
CAGATTCTGCAGCAGAAGCCGGCGCAGTACCTACGCTTCAACCAGCAGCAGCTCTCCCGC
ATCTACCCCTCCTCCTACCGTGTGGACTCCAGCAACTACAACCCGCAGCCCTTCTGGAAC
GCCGGCTGCCAAATGGTTGCCCTGAACTACCAGTCAGAGGGGCGGATGCTGCAGCTGAAC
CGAGCCAAGTTCAGCGCCAACGGTGGCTGCGGCTACGTACTCAAGCCTGGGTGCATGTGC
CAGGGCGTGTTCAACCCCAACTCGGAGGACCCCCTGCCCGGGCAGCTCAAGAAGCAGCTG
GTGCTCCGGATCATCAGTGGCCAGCAGCTTCCCAAGCCGCGCGACTCCATGCTGGGGGAC
CGTGGGGAGATCATCGACCCCTTTGTGGAGGTGGAGATCATTGGGCTCCCTGTGGACTGC
AGCAGGGAGCAGACCCGCGTGGTGGACGACAACGGGTTCAACCCCACCTGGGAGGAGACC
CTGGTTTTCATGGTGCACATGCCGGAGATCGCGCTGGTCCGCTTCCTCGTCTGGGACCAC
GATCCCATTGGGCGTGACTTCATTGGCCAGAGGACGCTGGCCTTCAGCAGCATGATGCCA
GGCTACAGACACGTGTACCTAGAAGGGATGGAAGAGGCCTCCATCTTCGTGCATGTGGCT
GTCAGTGACATCAGCGGTAAGGTCAAGCAGGCTCTGGGCCTAAAAGGCCTCTTCCTCCGA
GGCCCAAAGCCCGGCTCGCTGGACAGTCATGCTGCTGGGCGGCCCCCGGCCCGGCCCTCC
GTTAGCCAGCGGATCCTGCGGCGCACGGCCAGCGCCCCGACCAAGAGCCAGAAGCCGGGC
CGCAGGGGCTTCCCGGAGCTGGTCCTGGGTACACGGGACACAGGCTCCAAGGGGGTGGCA
GACGATGTGGTGCCCCCCGGGCCCGGACCTGCTCCGGAAGCCCCAGCCCAGGAGGGGCCC
GGCAGCGGCAGCCCCCGAGACACCCGCCCCCTCTCCACGCAGCGGCCACTCCCCCCACTG
TGCAGCCTGGAAACCATCGCTGAGGAGCCCGCCCCAGGCCCTGGTCCCCCGCCACCAGCG
GCTGTCCCCACCAGCTCTTCTCAGGGACGGCCCCCATACCCCACAGGACCCGGAGCCAAT
GTGGCAAGCCCCCTAGAGGACACTGAGGAGCCCCGAGACAGCAGGCCTCGGCCGTGCAAC
GGCGAGGGCGCCGGCGGGGCATACGAGAGGGCCCCCGGCAGCCAGACGGACGGCAGGAGC
CAGCCCCGGACCCTGGGCCACCTGCCCGTGATTAGAAGGGTGAAGAGTGAGGGGCAGGTG
CCCACGGAGCCCCTGGGAGGGTGGCGGCCCCTGGCCGCTCCCTTTCCAGCTCCTGCCGTG
TACTCCGATGCCACGGGCAGTGACCCGCTGTGGCAGCGGCTGGAGCCATGTGGCCACCGA
GACAGCGTTTCCTCCTCCTCCAGCATGTCATCCAGCGACACTGTCATTGACCTCTCCCTG
CCCAGCCTGGGCCTGGGCCGCAGCCGTGAGAACCTCGCTGGAGCCCACATGGGACGCCTG
CCCCCCAGGCCCCACTCGGCTTCGGCTGCCCGCCCAGACCTGCCACCTGTGACCAAGAGC
AAATCCAACCCCAACCTTCGGGCTACAGGCCAGCGGCCTCCCATACCTGACGAACTGCAG
CCCAGGTCCCTGGCCCCAAGGATGGCTGGCCTCCCCTTCCGGCCTCCCTGGGGCTGCCTT
TCCCTGGTGGGCGTGCAGGACTGCCCCGTGGCTGCCAAGTCCAAGAGCCTGGGCGACCTC
ACTGCTGATGACTTTGCCCCTAGCTTTGAGGGCGGCTCCCGCAGACTGAGCCACAGCCTG
GGCCTCCCGGGAGGGACACGGCGGGTGTCGGGGCCAGGGGTGAGACGGGACACCCTGACA
GAGCAGCTGCGCTGGCTCACTGTCTTCCAGCAGGCAGGAGACATCACGTCACCCACCAGC
CTGGGCCCGGCTGGGGAGGGGGTGGCAGGGGGCCCTGGTTTTGTGCGGCGCTCCTCCTCC
CGCAGCCACAGCCGCGTGCGTGCCATTGCCAGCCGGGCCCGCCAGGCCCAGGAGCGGCAG
CAGAGACTGCAGGGCCTGGGCCGGCAGGGACCCCCAGAAGAGGAGCGGGGCACCCCCGAG
GGCGCCTGCTCCGTGGGCCACGAGGGCAGTGTGGATGCACCAGCACCCTCCAAGGGAGCC
CTCGGGCCAGCATCCGCGGCTGCTGAAAACCTGGTCCTGCTCCGCCTCTGA
Protein Properties
Number of Residues 1416
Molecular Weight 154666.975
Theoretical pI 7.84
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase eta-2
MSGPWPSPDSRTKGTVAWLAEVLLWVGGSVVLSSEWQLGPLVERCMGAMQEGMQMVKLRG
GSKGLVRFYYLDEHRSCIRWRPSRKNEKAKISIDSIQEVSEGRQSEVFQRYPDGSFDPNC
CFSIYHGSHRESLDLVSTSSEVARTWVTGLRYLMAGISDEDSLARRQRTRDQWLKQTFDE
ADKNGDGSLSIGEVLQLLHKLNVNLPRQRVKQMFREADTDDHQGTLGFEEFCAFYKMMST
RRDLYLLMLTYSNHKDHLDAASLQRFLQVEQKMAGVTLESCQDIIEQFEPCPENKSKGLL
GIDGFTNYTRSPAGDIFNPEHHHVHQDMTQPLSHYFITSSHNTYLVGDQLMSQSRVDMYA
WVLQAGCRCVEVDCWDGPDGEPIVHHGYTLTSKILFKDVIETINKYAFIKNEYPVILSIE
NHCSVIQQKKMAQYLTDILGDKLDLSSVSSEDATTLPSPQMLKGKILVKGKKLPANISED
AEEGEVSDEDSADEIDDDCKLLNGDASTNRKRVENTAKRKLDSLIKESKIRDCEDPNNFS
VSTLSPSGKLGRKSKAEEDVESGEDAGASRRNGRLVVGSFSRRKKKGSKLKKAASVEEGD
EGQDSPGGQSRGATRQKKTMKLSRALSDLVKYTKSVATHDIEMEAASSWQVSSFSETKAH
QILQQKPAQYLRFNQQQLSRIYPSSYRVDSSNYNPQPFWNAGCQMVALNYQSEGRMLQLN
RAKFSANGGCGYVLKPGCMCQGVFNPNSEDPLPGQLKKQLVLRIISGQQLPKPRDSMLGD
RGEIIDPFVEVEIIGLPVDCSREQTRVVDDNGFNPTWEETLVFMVHMPEIALVRFLVWDH
DPIGRDFIGQRTLAFSSMMPGYRHVYLEGMEEASIFVHVAVSDISGKVKQALGLKGLFLR
GPKPGSLDSHAAGRPPARPSVSQRILRRTASAPTKSQKPGRRGFPELVLGTRDTGSKGVA
DDVVPPGPGPAPEAPAQEGPGSGSPRDTRPLSTQRPLPPLCSLETIAEEPAPGPGPPPPA
AVPTSSSQGRPPYPTGPGANVASPLEDTEEPRDSRPRPCNGEGAGGAYERAPGSQTDGRS
QPRTLGHLPVIRRVKSEGQVPTEPLGGWRPLAAPFPAPAVYSDATGSDPLWQRLEPCGHR
DSVSSSSSMSSSDTVIDLSLPSLGLGRSRENLAGAHMGRLPPRPHSASAARPDLPPVTKS
KSNPNLRATGQRPPIPDELQPRSLAPRMAGLPFRPPWGCLSLVGVQDCPVAAKSKSLGDL
TADDFAPSFEGGSRRLSHSLGLPGGTRRVSGPGVRRDTLTEQLRWLTVFQQAGDITSPTS
LGPAGEGVAGGPGFVRRSSSRSHSRVRAIASRARQAQERQQRLQGLGRQGPPEEERGTPE
GACSVGHEGSVDAPAPSKGALGPASAAAENLVLLRL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O75038
UniProtKB/Swiss-Prot Entry Name PLCH2_HUMAN
PDB IDs Not Available
GenBank Gene ID DQ176850
GeneCard ID PLCH2
GenAtlas ID PLCH2
HGNC ID HGNC:29037
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Seki N, Ohira M, Nagase T, Ishikawa K, Miyajima N, Nakajima D, Nomura N, Ohara O: Characterization of cDNA clones in size-fractionated cDNA libraries from human brain. DNA Res. 1997 Oct 31;4(5):345-9. [PubMed:9455484 ]
  4. Zhou Y, Wing MR, Sondek J, Harden TK: Molecular cloning and characterization of PLC-eta2. Biochem J. 2005 Nov 1;391(Pt 3):667-76. [PubMed:16107206 ]