You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01860
Secondary Accession Numbers
  • 7254
Name Type II inositol 1,4,5-trisphosphate 5-phosphatase
Synonyms
  1. 5PTase
  2. 75 kDa inositol polyphosphate-5-phosphatase
  3. Phosphoinositide 5-phosphatase
Gene Name INPP5B
Protein Type Unknown
Biological Properties
General Function Involved in inositol or phosphatidylinositol phosphatase activity
Specific Function Hydrolyzes phosphatidylinositol 4,5-bisphosphate (PtIns(4,5)P2) and the signaling molecule phosphatidylinositol 1,4,5-trisphosphate (PtIns(1,4,5)P3), and thereby modulates cellular signaling events.
Pathways
  • Inositol phosphate metabolism
  • Phosphatidylinositol signaling system
Reactions
1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + Water → 1-phosphatidyl-1D-myo-inositol 4-phosphate + Phosphoric acid details
1-Phosphatidyl-D-myo-inositol 4,5-bisphosphate + Water → 1-Phosphatidyl-1D-myo-inositol 4-phosphate + Phosphoric acid details
GO Classification
Biological Process
spermatogenesis
phosphatidylinositol dephosphorylation
regulation of protein processing
regulation of small GTPase mediated signal transduction
sperm motility
phosphatidylinositol phosphorylation
small GTPase mediated signal transduction
Cellular Component
cytosol
microtubule cytoskeleton
Golgi apparatus
early endosome membrane
phagocytic vesicle membrane
endoplasmic reticulum-Golgi intermediate compartment
membrane
integral to membrane
Component
cell part
intracellular
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
inositol or phosphatidylinositol phosphatase activity
Molecular Function
metal ion binding
inositol-1,4,5-trisphosphate 5-phosphatase activity
phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location 1
Locus 1p34
SNPs INPP5B
Gene Sequence
>2982 bp
ATGGACCAGTCTGTGGCAATCCAGGAGACGCTGGCTGAGGGGGAATACTGCGTCATCGCG
GTGCAAGGTGTGCTGTGTGAGGGGGACAGCCGGCAGAGCCGCCTCCTGGGACTCGTGCGC
TACCGCCTGGAGCACGGCGGCCAGGAACACGCTCTCTTCCTCTATACGCACCGGAGGATG
GCCATTACCGGGGACGATGTCTCTCTGGACCAGATAGTGCCAGTCTCGCGGGATTTTACG
CTGGAAGAAGTGTCCCCAGATGGTGAACTCTACATCCTTGGCTCAGATGTGACCGTCCAG
CTGGACACAGCAGAGCTTAGCCTCGTATTCCAACTGCCCTTTGGTTCACAAACCAGGATG
TTCCTCCACGAAGTTGCCAGGGCCTGTCCAGGCTTCGATTCTGCGACCCGGGATCCTGAA
TTCCTGTGGCTGTCTCGGTATAGGTGCGCAGAGCTGGAGCTGGAGATGCCAACGCCGCGC
GGTTGTAACTCGGCCCTAGTTACCTGGCCAGGGTACGCGACAATTGGCGGAGGCAGGTAT
CCGTCCCGGAAGAAACGGTGGGGATTGGAGGAGGCCCGGCCACAGGGGGCGGGCTCCGTT
CTGTTTTGGGGCGGAGCGATGGAGAAGACAGGCTTTCGATTGATGGAGCGGGCACACGGG
GGCGGGTTCGTCTGGGGGCGGAGCGCGCGGGACGGGCGGCGGGATGAGGAGCTTGAGGAA
GCAGGCAGGGAAATGTCTGCCGCCGCCGGCTCTCGGGAGCGCAACACTGCAGGTGGTTCT
AACTTTGATGGTTTGAGACCAAATGGGAAGGGAGTGCCTATGGACCAAAGCTCCAGGGGT
CAAGATAAACCAGAAAGCTTGCAACCAAGACAGAATAAATCCAAGTCCGAAATTACTGAC
ATGGTTCGCTCCTCCACTATCACAGTGTCGGACAAGGCTCATATTTTATCCATGCAGAAG
TTTGGACTGCGAGATACAATTGTGAAATCACATCTACTACAGAAAGAAGAGGATTACACC
TATATCCAGAACTTCAGGTTTTTTGCGGGAACATACAATGTAAATGGGCAGTCCCCCAAA
GAATGCCTCCGGCTGTGGCTGAGCAATGGTATCCAGGCCCCAGATGTCTATTGTGTAGGG
TTCCAGGAGCTTGATCTGAGTAAGGAAGCTTTTTTCTTTCACGATACCCCAAAGGAGGAA
GAGTGGTTCAAAGCTGTGTCAGAGGGTCTTCATCCAGATGCCAAATATGCAAAGGTGAAG
CTTATCCGACTGGTTGGGATTATGCTGCTGTTATATGTCAAACAGGAGCATGCAGCTTAT
ATCTCAGAAGTGGAAGCCGAGACTGTGGGGACAGGAATCATGGGGAGGATGGGCAACAAG
GGAGGCGTGGCGATCAGGTTCCAGTTCCACAACACCAGCATCTGCGTTGTGAATTCTCAC
TTGGCAGCCCACATTGAAGAGTATGAGAGGAGGAACCAGGACTATAAGGACATTTGTTCT
CGAATGCAGTTTTGTCAGCCTGACCCAAGCCTTCCCCCTCTCACCATCAGCAACCATGAT
GTGATCTTGTGGCTGGGGGACCTCAACTACAGGATAGAAGAGCTGGATGTGGAAAAAGTG
AAAAAGCTCATCGAAGAGAAGGACTTTCAAATGCTGTATGCATATGATCAGCTGAAAATT
CAGGTGGCCGCAAAGACTGTCTTTGAAGGCTTCACAGAGGGTGAGCTCACATTCCAGCCT
ACTTACAAGTATGATACGGGCTCTGACGACTGGGATACCAGTGAGAAGTGCCGTGCTCCT
GCCTGGTGTGATCGGATTCTCTGGAAAGGGAAGAACATCACTCAGCTGAGTTACCAGAGC
CACATGGCCCTGAAGACCAGTGACCACAAGCCTGTCAGCTCAGTGTTTGACATCGGGGTG
AGGGTCGTAAATGACGAGCTTTACCGGAAGACACTGGAGGAAATTGTTCGCTCCCTGGAT
AAGATGGAAAATGCCAACATTCCTTCTGTGTCCCTGTCCAAGCGAGAGTTCTGTTTTCAG
AATGTGAAGTACATGCAATTGAAAGTAGAATCCTTTACAATTCATAATGGACAAGTACCC
TGTCATTTTGAATTCATCAACAAGCCTGATGAAGAGTCTTACTGTAAGCAGTGGCTGAAT
GCCAACCCCAGCAGAGGCTTCCTCCTGCCAGATTCTGATGTTGAGATTGACTTGGAGCTC
TTCGTAAATAAGATGACAGCTACAAAGCTCAACTCGGGTGAAGACAAAATTGAGGACATT
CTGGTTCTGCACTTGGACAGGGGAAAGGATTACTTTTTGTCTGTGTCTGGGAACTACCTG
CCCAGCTGTTTTGGGTCTCCCATTCATACACTGTGTTACATGAGAGAGCCAATCTTGGAC
CTACCACTTGAAACCATTAGTGAGCTGACTCTGATGCCAGTATGGACTGGAGATGATGGG
AGCCAGTTGGATAGCCCCATGGAAATCCCCAAAGAGCTCTGGATGATGGTTGATTACCTG
TACCGAAATGCTGTCCAGCAGGAAGATCTGTTTCAGCAACCAGGCCTGAGGTCAGAATTT
GAACATATCAGGGACTGCTTGGATACTGGAATGATTGATAACCTCTCTGCCAGCAATCAT
TCTGTAGCCGAAGCCCTGCTGCTTTTCCTGGAGAGCCTTCCAGAGCCTGTCATCTGTTAC
AGCACCTACCATAACTGCTTGGAGTGTTCTGGCAACTACACAGCAAGCAAACAGGTCATT
TCTACTCTCCCCATATTCCACAAAAATGTCTTCCACTACTTGATGGCGTTTTTGCGAGAA
CTGCTGAAAAATTCAGCAAAAAATCATTTGGATGAGAATATTCTAGCTAGCATATTTGGC
AGCTTATTGCTTCGAAACCCAGCTGGTCACCAAAAGCTTGATATGACAGAGAAGAAGAAG
GCTCAAGAATTTATTCACCAGTTCCTCTGCAACCCACTCTGA
Protein Properties
Number of Residues 993
Molecular Weight 103986.41
Theoretical pI 5.357
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Type II inositol-1,4,5-trisphosphate 5-phosphatase
MDQSVAIQETLAEGEYCVIAVQGVLCEGDSRQSRLLGLVRYRLEHGGQEHALFLYTHRRM
AITGDDVSLDQIVPVSRDFTLEEVSPDGELYILGSDVTVQLDTAELSLVFQLPFGSQTRM
FLHEVARACPGFDSATRDPEFLWLSRYRCAELELEMPTPRGCNSALVTWPGYATIGGGRY
PSRKKRWGLEEARPQGAGSVLFWGGAMEKTGFRLMERAHGGGFVWGRSARDGRRDEELEE
AGREMSAAAGSRERNTAGGSNFDGLRPNGKGVPMDQSSRGQDKPESLQPRQNKSKSEITD
MVRSSTITVSDKAHILSMQKFGLRDTIVKSHLLQKEEDYTYIQNFRFFAGTYNVNGQSPK
ECLRLWLSNGIQAPDVYCVGFQELDLSKEAFFFHDTPKEEEWFKAVSEGLHPDAKYAKVK
LIRLVGIMLLLYVKQEHAAYISEVEAETVGTGIMGRMGNKGGVAIRFQFHNTSICVVNSH
LAAHIEEYERRNQDYKDICSRMQFCQPDPSLPPLTISNHDVILWLGDLNYRIEELDVEKV
KKLIEEKDFQMLYAYDQLKIQVAAKTVFEGFTEGELTFQPTYKYDTGSDDWDTSEKCRAP
AWCDRILWKGKNITQLSYQSHMALKTSDHKPVSSVFDIGVRVVNDELYRKTLEEIVRSLD
KMENANIPSVSLSKREFCFQNVKYMQLKVESFTIHNGQVPCHFEFINKPDEESYCKQWLN
ANPSRGFLLPDSDVEIDLELFVNKMTATKLNSGEDKIEDILVLHLDRGKDYFLSVSGNYL
PSCFGSPIHTLCYMREPILDLPLETISELTLMPVWTGDDGSQLDSPMEIPKELWMMVDYL
YRNAVQQEDLFQQPGLRSEFEHIRDCLDTGMIDNLSASNHSVAEALLLFLESLPEPVICY
STYHNCLECSGNYTASKQVISTLPIFHKNVFHYLMAFLRELLKNSAKNHLDENILASIFG
SLLLRNPAGHQKLDMTEKKKAQEFIHQFLCNPL
GenBank ID Protein 55665969
UniProtKB/Swiss-Prot ID P32019
UniProtKB/Swiss-Prot Entry Name I5P2_HUMAN
PDB IDs
GenBank Gene ID AL603790
GeneCard ID INPP5B
GenAtlas ID INPP5B
HGNC ID HGNC:6077
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Jefferson AB, Majerus PW: Properties of type II inositol polyphosphate 5-phosphatase. J Biol Chem. 1995 Apr 21;270(16):9370-7. [PubMed:7721860 ]
  5. Ross TS, Jefferson AB, Mitchell CA, Majerus PW: Cloning and expression of human 75-kDa inositol polyphosphate-5-phosphatase. J Biol Chem. 1991 Oct 25;266(30):20283-9. [PubMed:1718960 ]