You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01921
Secondary Accession Numbers
  • 7329
Name Aggrecan core protein
Synonyms
  1. Aggrecan core protein 2
  2. CSPCP
  3. Cartilage-specific proteoglycan core protein
  4. Chondroitin sulfate proteoglycan 1
  5. Chondroitin sulfate proteoglycan core protein 1
Gene Name ACAN
Protein Type Enzyme
Biological Properties
General Function Involved in binding
Specific Function This proteoglycan is a major component of extracellular matrix of cartilagenous tissues. A major function of this protein is to resist compression in cartilage. It binds avidly to hyaluronic acid via an N-terminal globular region
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
pattern binding
polysaccharide binding
glycosaminoglycan binding
hyaluronic acid binding
Process
cell adhesion
cellular process
Cellular Location
  1. Secreted
  2. extracellular space
  3. extracellular matrix
Gene Properties
Chromosome Location Chromosome:1
Locus 15q26.1
SNPs ACAN
Gene Sequence
>7593 bp
ATGACCACTTTACTCTGGGTTTTCGTGACTCTGAGGGTCATCACTGCAGCTGTCACTGTA
GAAACTTCAGACCATGACAACTCGCTGAGTGTCAGCATCCCCCAACCGTCCCCGCTGAGG
GTCCTCCTGGGGACCTCCCTCACCATCCCCTGCTATTTCATCGACCCCATGCACCCTGTG
ACCACCGCCCCTTCTACCGCCCCACTGGCCCCAAGAATCAAGTGGAGCCGTGTGTCCAAG
GAGAAGGAGGTAGTGCTGCTGGTGGCCACTGAAGGGCGCGTGCGGGTCAACAGTGCCTAT
CAGGACAAGGTCTCACTGCCCAACTACCCGGCCATCCCCAGTGACGCCACCTTGGAAGTC
CAGAGCCTGCGCTCCAATGACTCTGGGGTCTACCGCTGCGAGGTGATGCATGGCATCGAG
GACAGCGAGGCCACCCTGGAAGTCGTGGTGAAAGGCATCGTGTTCCATTACAGAGCCATC
TCTACACGCTACACCCTCGACTTTGACAGGGCGCAGCGGGCCTGCCTGCAGAACAGTGCC
ATCATTGCCACGCCTGAGCAGCTGCAGGCCGCCTACGAAGACGGCTTCCACCAGTGTGAC
GCCGGCTGGCTGGCTGACCAGACTGTCAGATACCCCATCCACACTCCCCGGGAAGGCTGC
TATGGAGACAAGGATGAGTTTCCTGGTGTGAGGACGTATGGCATCCGAGACACCAACGAG
ACCTATGATGTGTACTGCTTCGCCGAGGAGATGGAGGGTGAGGTCTTTTATGCAACATCT
CCAGAGAAGTTCACCTTCCAGGAAGCAGCCAATGAGTGCCGGCGGCTGGGTGCCCGGCTG
GCCACCACGGGCCAGCTCTACCTGGCCTGGCAGGCTGGCATGGACATGTGCAGCGCCGGC
TGGCTGGCCGACCGCAGCGTGCGCTACCCCATCTCCAAGGCCCGGCCCAACTGCGGTGGC
AACCTCCTGGGCGTGAGGACCGTCTACGTGCATGCCAACCAGACGGGCTACCCCGACCCC
TCATCCCGCTACGACGCCATCTGCTACACAGGTGAAGACTTTGTGGACATCCCAGAAAAC
TTCTTTGGAGTGGGGGGTGAGGAGGACATCACCGTCCAGACAGTGACCTGGCCTGACATG
GAGCTGCCACTGCCTCGAAACATCACTGAGGGTGAAGCCCGAGGCAGCGTGATCCTTACC
GTAAAGCCCATCTTCGAGGTCTCCCCCAGTCCCCTGGAACCCGAGGAGCCCTTCACGTTT
GCCCCTGAAATAGGGGCCACTGCCTTCGCTGAGGTTGAGAATGAGACTGGAGAGGCCACC
AGGCCCTGGGGCTTTCCCACACCTGGCCTGGGCCCTGCCACGGCATTCACCAGTGAGGAC
CTCGTCGTGCAGGTGACCGCTGTCCCTGGGCAGCCGCATTTGCCAGGGGGGGTCGTCTTC
CACTACCGCCCGGGACCCACCCGCTACTCGCTGACCTTTGAGGAGGCACAGCAGGCCTGC
CTGCGCACGGGGGCGGTCATTGCCTCGCCGGAGCAGCTCCAGGCCGCCTACGAAGCAGGC
TATGAGCAGTGTGACGCCGGCTGGCTGCGGGACCAGACCGTCAGATACCCCATTGTGAGC
CCCCGGACCCCATGCGTGGGTGACAAGGACAGCAGCCCAGGGGTCAGGACCTATGGCGTG
CGCCCATCAACAGAGACCTACGATGTCTACTGCTTTGTAGACAGACTTGAGGGGGAGGTG
TTCTTCGCCACACGCCTTGAGCAGTTCACCTTCCAGGAAGCACTGGAGTTCTGTGAATCT
CACAATGCTACGCTGGCCACCACGGGCCAGCTCTACGCCGCCTGGAGCCGCGGCCTGGAC
AAGTGCTATGCCGGCTGGCTGGCCGACGGCAGCCTCCGCTACCCCATCGTCACCCCAAGG
CCTGCCTGCGGTGGGGACAAGCCAGGCGTGAGAACGGTCTACCTCTACCCTAACCAGACG
GGCCTCCCAGACCCACTGTCCCGGCACCATGCCTTCTGCTTCCGAGGCATTTCAGCGGTT
CCTTCTCCAGGAGAAGAAGAGGGTGGCACACCCACATCACCCTCTGGTGTGGAGGAGTGG
ATCGTGACCCAAGTGGTTCCTGGTGTGGCTGCTGTCCCCGTAGAAGAGGAGACAACTGCT
GTACCCTCAGGGGAGACTACTGCCATCCTAGAGTTCACCACCGAGCCAGAAAACCAGACA
GAATGGGAACCAGCCTATACCCCAGTGGGCACATCCCCGCTGCCAGGGATCCTTCCTACT
TGGCCTCCCACTGGCGCAGCAACAGAGGAAAGTACAGAAGGCCCTTCTGCAACTGAAGTG
CCCTCTGCCTCAGAGGAACCATCCCCCTCAGAGGTGCCATTCCCCTCAGAGGAGCCATCC
CCCTCAGAGGAACCATTCCCCTCAGTGAGGCCATTCCCCTCAGTGGAGCTGTTCCCCTCA
GAGGAGCCATTCCCCTCCAAGGAGCCATCCCCCTCAGAGGAACCATCAGCCTCGGAAGAG
CCGTATACACCTTCACCCCCCGTGCCCAGCTGGACTGAGCTGCCCAGCTCTGGGGAGGAA
TCTGGGGCCCCTGATGTCAGTGGTGACTTCACAGGCAGTGGAGATGTTTCAGGACACCTT
GACTTCAGTGGGCAGCTGTCAGGGGACAGGGCAAGTGGACTGCCCTCTGGAGACCTGGAC
TCCAGTGGTCTTACTTCCACAGTGGGCTCAGGCCTGCCTGTGGAAAGTGGACTACCCTCA
GGGGATGAAGAGAGAATTGAGTGGCCCAGCACTCCTACGGTTGGTGAACTGCCCTCTGGA
GCTGAGATCCTAGAGGGCTCTGCCTCTGGAGTTGGGGATCTCAGTGGACTTCCTTCTGGA
GAAGTTCTAGAGACCTCTGCCTCTGGAGTAGGAGACCTCAGTGGGCTTCCTTCTGGAGAA
GTTCTAGAGACCACTGCCCCTGGAGTAGAGGACATCAGCGGGCTTCCTTCTGGAGAAGTT
CTAGAGACCACTGCCCCTGGAGTAGAGGACATCAGCGGGCTTCCTTCTGGAGAAGTTCTA
GAGACCACTGCCCCTGGAGTAGAGGACATCAGCGGGCTTCCTTCTGGAGAAGTTCTAGAG
ACCACTGCCCCTGGAGTAGAGGACATCAGCGGGCTTCCTTCTGGAGAAGTTCTAGAGACC
ACTGCCCCTGGAGTAGAGGACATCAGCGGGCTTCCTTCTGGAGAAGTTCTAGAGACCACT
GCCCCTGGAGTAGAGGACATCAGCGGGCTTCCTTCTGGAGAAGTTCTAGAGACCGCTGCC
CCTGGAGTAGAGGACATCAGCGGGCTTCCTTCTGGAGAAGTTCTAGAGACCGCTGCCCCT
GGAGTAGAGGACATCAGCGGGCTTCCTTCTGGAGAAGTTCTAGAGACCGCTGCCCCTGGA
GTAGAGGACATCAGCGGGCTTCCTTCTGGAGAAGTTCTAGAGACCGCTGCCCCTGGAGTA
GAGGACATCAGCGGGCTTCCTTCTGGAGAAGTTCTAGAGACCGCTGCCCCTGGAGTAGAG
GACATCAGCGGGCTTCCTTCTGGAGAAGTTCTAGAGACCGCTGCCCCTGGAGTAGAGGAC
ATCAGCGGGCTTCCTTCTGGAGAAGTTCTAGAGACCGCTGCCCCTGGAGTAGAGGACATC
AGCGGGCTTCCTTCTGGAGAAGTTCTAGAGACTGCTGCCCCTGGAGTAGAGGACATCAGC
GGGCTTCCTTCTGGAGAAGTTCTAGAGACTGCTGCCCCTGGAGTAGAGGACATCAGCGGG
CTTCCTTCTGGAGAAGTTCTAGAGACTGCTGCCCCTGGAGTAGAGGACATCAGCGGGCTT
CCTTCTGGAGAAGTTCTAGAGACTGCTGCCCCTGGAGTAGAGGACATCAGCGGGCTTCCT
TCTGGAGAAGTTCTAGAGACTGCTGCCCCTGGAGTAGAGGACATCAGCGGGCTTCCTTCT
GGAGAAGTTCTAGAGACTGCTGCCCCTGGAGTAGAGGACATCAGCGGGCTTCCTTCTGGA
GAAGTTCTAGAGACTGCTGCCCCTGGAGTAGAGGACATCAGCGGGCTTCCTTCTGGAGAA
GTTCTAGAGACTGCTGCCCCTGGAGTAGAGGACATCAGCGGGCTTCCTTCTGGAGAAGTT
CTAGAGACTGCTGCCCCTGGAGTAGAGGACATCAGCGGGCTTCCTTCTGGAGAAGTTCTA
GAGACTACTGCCCCTGGAGTAGAGGAGATCAGCGGGCTTCCTTCTGGAGAAGTTCTAGAG
ACTACTGCCCCTGGAGTAGATGAGATCAGTGGGCTTCCTTCTGGAGAAGTTCTAGAGACT
ACTGCCCCTGGAGTAGAGGAGATCAGCGGGCTTCCTTCTGGAGAAGTTCTAGAGACTTCT
ACCTCTGCGGTAGGGGACCTCAGTGGACTTCCTTCTGGAGGAGAAGTTCTAGAGATTTCT
GTCTCTGGAGTAGAGGACATCAGTGGGCTTCCTTCTGGAGAGGTTGTAGAGACTTCTGCC
TCTGGAATAGAGGATGTCAGTGAACTTCCTTCAGGAGAAGGTCTAGAGACCTCTGCTTCT
GGAGTAGAGGACCTCAGCAGGCTCCCTTCTGGAGAAGAAGTTCTAGAGATTTCTGCCTCT
GGATTTGGGGACCTCAGTGGACTTCCTTCTGGAGGAGAAGGTCTAGAGACCTCTGCTTCT
GAAGTAGGGACTGACCTCAGTGGGCTTCCTTCTGGAAGGGAGGGTCTAGAGACTTCAGCT
TCTGGAGCTGAGGACCTCAGTGGGTTGCCTTCTGGAAAAGAAGACTTGGTGGGGTCAGCT
TCTGGAGACTTGGACTTGGGCAAACTGCCTTCTGGAACTCTAGGAAGTGGGCAAGCTCCA
GAAACAAGTGGTCTTCCCTCTGGATTTAGTGGTGAGTATTCTGGGGTGGACCTTGGAAGT
GGCCCACCCTCTGGCCTGCCTGACTTTAGTGGACTTCCATCTGGATTCCCAACTGTTTCC
CTAGTGGATTCTACATTGGTGGAAGTGGTCACAGCCTCCACTGCAAGTGAACTGGAAGGG
AGGGGAACCATTGGCATCAGTGGTGCAGGAGAAATATCTGGACTGCCCTCCAGTGAGCTG
GACATTAGTGGGAGAGCTAGTGGACTCCCTTCAGGAACTGAACTCAGTGGCCAAGCATCT
GGGTCTCCTGATGTCAGTGGGGAAATACCTGGACTCTTTGGTGTCAGTGGACAGCCATCA
GGGTTTCCTGACACTAGTGGGGAAACATCTGGAGTGACTGAGCTTAGCGGGCTGTCCTCT
GGACAACCAGGTATTAGTGGAGAAGCATCTGGAGTTCTTTATGGCACTAGTCAACCCTTT
GGCATAACTGATCTGAGTGGAGAAACATCTGGGGTCCCTGATCTCAGTGGGCAGCCTTCA
GGGTTACCAGGGTTCAGTGGGGCAACATCAGGAGTCCCTGACCTGGTTTCTGGTACCACG
AGTGGCAGCGGTGAATCTTCTGGGATTACATTTGTGGACACCAGTTTGGTTGAAGTGGCC
CCTACTACATTTAAAGAAGAAGAAGGCTTAGGGTCTGTGGAACTCAGTGGCCTCCCTTCC
GGAGAGGCAGATCTGTCAGGCAAATCTGGGATGGTGGATGTCAGTGGACAGTTTTCTGGA
ACAGTCGATTCCAGTGGGTTTACATCCCAGACTCCGGAATTCAGTGGCCTACCAAGTGGC
ATAGCTGAGGTCAGTGGAGAATCCTCCAGAGCTGAGATTGGGAGCAGCCTGCCCTCGGGA
GCATATTATGGCAGTGGAACTCCATCTAGTTTCCCCACTGTCTCTCTTGTAGACAGAACT
TTGGTGGAATCTGTAACCCAGGCTCCAACAGCCCAAGAGGCAGGAGAAGGGCCTTCTGGC
ATTTTAGAACTCAGTGGTGCTCATTCTGGAGCACCAGACATGTCTGGGGAGCATTCTGGA
TTTCTGGACCTAAGTGGGCTGCAGTCCGGGCTGATAGAGCCCAGCGGAGAGCCACCAGGT
ACTCCATATTTTAGTGGGGATTTTGCCAGCACCACCAATGTAAGTGGAGAATCCTCTGTA
GCCATGGGCACCAGTGGAGAGGCCTCAGGACTTCCAGAAGTTACTTTAATCACTTCTGAG
TTCGTGGAGGGTGTTACTGAACCAACTATTTCTCAGGAACTAGGCCAAAGGCCCCCTGTG
ACACACACACCCCAGCTTTTTGAGTCCAGTGGAAAAGTCTCCACAGCTGGGGACATTAGT
GGAGCTACCCCAGTGCTCCCTGGGTCTGGAGTAGAAGTATCATCAGTCCCAGAATCTAGC
AGTGAGACGTCCGCCTATCCTGAAGCTGGGTTCGGGGCATCTGCCGCCCCTGAGGCCAGC
AGAGAAGATTCTGGGTCCCCTGATCTGAGTGAAACCACCTCTGCATTCCACGAAGCTAAC
CTTGAGAGATCCTCTGGCCTAGGAGTGAGCGGCAGCACTTTGACATTTCAAGAAGGCGAG
GCGTCCGCTGCCCCAGAAGTGAGTGGAGAATCCACCACCACCAGTGATGTGGGGACAGAG
GCACCAGGCTTGCCTTCAGCCACTCCCACGGCTTCTGGAGACAGGACTGAAATCAGCGGA
GACCTGTCTGGTCACACCTCGCAGCTGGGCGTTGTCATCAGCACCAGCATCCCAGAGTCT
GAGTGGACCCAGCAGACCCAGCGCCCTGCAGAGACGCATCTAGAAATTGAGTCCTCAAGC
CTCCTGTACTCAGGAGAAGAGACTCACACAGTCGAAACAGCCACCTCCCCAACAGATGCT
TCCATCCCAGCTTCTCCGGAATGGAAACGTGAATCAGAATCAACTGCTGCAGCCCCCGCC
AGGTCCTGTGCAGAGGAGCCCTGTGGAGCTGGGACCTGCAAGGAGACAGAGGGACACGTC
ATATGCCTGTGCCCCCCTGGCTACACTGGCGAGCACTGTAACATAGACCAGGAGGTATGT
GAGGAGGGCTGGAACAAGTACCAGGGCCACTGTTACCGCCACTTCCCGGACCGCGAGACC
TGGGTGGATGCTGAGCGCCGGTGTCGGGAGCAGCAGTCACACCTGAGCAGCATCGTCACC
CCCGAGGAGCAGGAGTTTGTCAACAACAATGCCCAAGACTACCAGTGGATCGGCCTGAAC
GACAGGACCATCGAAGGGGACTTCCGCTGGTCAGATGGACACCCCATGCAATTTGAGAAC
TGGCGCCCCAACCAGCCTGACAACTTTTTTGCCGCTGGAGAGGACTGTGTGGTGATGATC
TGGCACGAGAAGGGCGAGTGGAATGATGTTCCCTGCAATTACCACCTCCCCTTCACGTGT
AAAAAGGGCACAGTGGCCTGCGGAGAGCCCCCTGTGGTGGAGCATGCCAGGACCTTCGGG
CAGAAGAAGGACCGGTATGAGATCAATTCCCTGGTGCGGTACCAGTGCACAGAGGGGTTT
GTCCAGCGCCACATGCCCACCATCCGGTGCCAGCCCAGCGGGCACTGGGAGGAGCCTCAG
ATCACCTGCACAGACCCCACCACCTACAAACGCAGACTACAGAAGCGGAGCTCACGGCAC
CCTCGGAGGAGCCGCCCCAGCACAGCCCACTGA
Protein Properties
Number of Residues 2415
Molecular Weight 250190.9
Theoretical pI 3.82
Pfam Domain Function
Signals
  • 1-16
Transmembrane Regions
  • None
Protein Sequence
>Aggrecan core protein
MTTLLWVFVTLRVITAAVTVETSDHDNSLSVSIPQPSPLRVLLGTSLTIPCYFIDPMHPV
TTAPSTAPLAPRIKWSRVSKEKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEV
QSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGIVFHYRAISTRYTLDFDRAQRACLQNSA
IIATPEQLQAAYEDGFHQCDAGWLADQTVRYPIHTPREGCYGDKDEFPGVRTYGIRDTNE
TYDVYCFAEEMEGEVFYATSPEKFTFQEAANECRRLGARLATTGHVYLAWQAGMDMCSAG
WLADRSVRYPISKARPNCGGNLLGVRTVYVHANQTGYPDPSSRYDAICYTGEDFVDIPEN
FFGVGGEEDITVQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLEPEEPFTF
APEIGATAFAEVENETGEATRPWGFPTPGLGPATAFTSEDLVVQVTAVPGQPHLPGGVVF
HYRPGPTRYSLTFEEAQQACPGTGAVIASPEQLQAAYEAGYEQCDAGWLRDQTVRYPIVS
PRTPCVGDKDSSPGVRTYGVRPSTETYDVYCFVDRLEGEVFFATRLEQFTFQEALEFCES
HNATATTGQLYAAWSRGLDKCYAGWLADGSLRYPIVTPRPACGGDKPGVRTVYLYPNQTG
LPDPLSRHHAFCFRGISAVPSPGEEEGGTPTSPSGVEEWIVTQVVPGVAAVPVEEETTAV
PSGETTAILEFTTEPENQTEWEPAYTPVGTSPLPGILPTWPPTGAETEESTEGPSATEVP
SASEEPSPSEVPFPSEEPSPSEEPFPSVRPFPSVELFPSEEPFPSKEPSPSEEPSASEEP
YTPSPPEPSWTELPSSGEESGAPDVSGDFTGSGDVSGHLDFSGQLSGDRASGLPSGDLDS
SGLTSTVGSGLTVESGLPSGDEERIEWPSTPTVGELPSGAEILEGSASGVGDLSGLPSGE
VLETSASGVGDLSGLPSGEVLETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLE
TTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETAA
PGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGV
EDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDI
SGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGL
PSGEVLETAAPGVEDISGLPSGEVLETTAPGVEEISGLPSGEVLETTAPGVDEISGLPSG
EVLETTAPGVEEISGLPSGEVLETSTSAVGDLSGLPSGGEVLEISVSGVEDISGLPSGEV
VETSASGIEDVSELPSGEGLETSASGVEDLSRLPSGEEVLEISASGFGDLSGVPSGGEGL
ETSASEVGTDLSGLPSGREGLETSASGAEDLSGLPSGKEDLVGSASGDLDLGKLPSGTLG
SGQAPETSGLPSGFSGEYSGVDLGSGPPSGLPDFSGLPSGFPTVSLVDSTLVEVVTASTA
SELEGRGTIGISGAGEISGLPSSELDISGRASGLPSGTELSGQASGSPDVSGEIPGLFGV
SGQPSGFPDTSGETSGVTELSGLSSGQPGVSGEASGVLYGTSQPFGITDLSGETSGVPDL
SGQPSGLPGFSGATSGVPDLVSGTTSGSGESSGITFVDTSLVEVAPTTFKEEEGLGSVEL
SGLPSGEADLSGKSGMVDVSGQFSGTVDSSGFTSQTPEFSGLPSGIAEVSGESSRAEIGS
SLPSGAYYGSGTPSSFPTVSLVDRTLVESVTQAPTAQEAGEGPSGILELSGAHSGAPDMS
GEHSGFLDLSGLQSGLIEPSGEPPGTPYFSGDFASTTNVSGESSVAMGTSGEASGLPEVT
LITSEFVEGVTEPTISQELGQRPPVTHTPQLFESSGKVSTAGDISGATPVLPGSGVEVSS
VPESSSETSAYPEAGFGASAAPEASREDSGSPDLSETTSAFHEANLERSSGLGVSGSTLT
FQEGEASAAPEVSGESTTTSDVGTEAPGLPSATPTASGDRTEISGDLSGHTSQLGVVIST
SIPESEWTQQTQRPAETHLEIESSSLLYSGEETHTVETATSPTDASIPASPEWKRESEST
AAAPARSCAEEPCGAGTCKETEGHVICLCPPGYTGEHCNIDQEVCEEGWNKYQGHCYRHF
PDRETWVDAERRCREQQSHLSSIVTPEEQEFVNNNAQDYQWIGLNDRTIEGDFRWSDGHP
MQFENWRPNQPDNFFAAGEDCVVMIWHEKGEWNDVPCNYHLPFTCKKGTVACGEPPVVEH
ARTFGQKKDRYEINSLVRYQCTEGFVQRHMPTIRCQPSGHWEEPRITCTDATTYKRRLQK
RSSRHPRRSRPSTAH
GenBank ID Protein 256017257
UniProtKB/Swiss-Prot ID P16112
UniProtKB/Swiss-Prot Entry Name PGCA_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_013227
GeneCard ID ACAN
GenAtlas ID ACAN
HGNC ID HGNC:319
References
General References
  1. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952 ]
  2. Doege KJ, Sasaki M, Kimura T, Yamada Y: Complete coding sequence and deduced primary structure of the human cartilage large aggregating proteoglycan, aggrecan. Human-specific repeats, and additional alternatively spliced forms. J Biol Chem. 1991 Jan 15;266(2):894-902. [PubMed:1985970 ]
  3. Ilic MZ, Mok MT, Williamson OD, Campbell MA, Hughes CE, Handley CJ: Catabolism of aggrecan by explant cultures of human articular cartilage in the presence of retinoic acid. Arch Biochem Biophys. 1995 Sep 10;322(1):22-30. [PubMed:7574678 ]
  4. Sandy JD, Flannery CR, Neame PJ, Lohmander LS: The structure of aggrecan fragments in human synovial fluid. Evidence for the involvement in osteoarthritis of a novel proteinase which cleaves the Glu 373-Ala 374 bond of the interglobular domain. J Clin Invest. 1992 May;89(5):1512-6. [PubMed:1569188 ]
  5. Glumoff V, Savontaus M, Vehanen J, Vuorio E: Analysis of aggrecan and tenascin gene expression in mouse skeletal tissues by northern and in situ hybridization using species specific cDNA probes. Biochim Biophys Acta. 1994 Nov 22;1219(3):613-22. [PubMed:7524681 ]
  6. Lohmander LS, Neame PJ, Sandy JD: The structure of aggrecan fragments in human synovial fluid. Evidence that aggrecanase mediates cartilage degradation in inflammatory joint disease, joint injury, and osteoarthritis. Arthritis Rheum. 1993 Sep;36(9):1214-22. [PubMed:8216415 ]
  7. Barry FP, Neame PJ, Sasse J, Pearson D: Length variation in the keratan sulfate domain of mammalian aggrecan. Matrix Biol. 1994 Aug;14(4):323-8. [PubMed:7827755 ]
  8. Dudhia J, Davidson CM, Wells TM, Vynios DH, Hardingham TE, Bayliss MT: Age-related changes in the content of the C-terminal region of aggrecan in human articular cartilage. Biochem J. 1996 Feb 1;313 ( Pt 3):933-40. [PubMed:8611178 ]
  9. Baldwin CT, Reginato AM, Prockop DJ: A new epidermal growth factor-like domain in the human core protein for the large cartilage-specific proteoglycan. Evidence for alternative splicing of the domain. J Biol Chem. 1989 Sep 25;264(27):15747-50. [PubMed:2789216 ]
  10. Gleghorn L, Ramesar R, Beighton P, Wallis G: A mutation in the variable repeat region of the aggrecan gene (AGC1) causes a form of spondyloepiphyseal dysplasia associated with severe, premature osteoarthritis. Am J Hum Genet. 2005 Sep;77(3):484-90. Epub 2005 Jul 22. [PubMed:16080123 ]
  11. Chen FH, Herndon ME, Patel N, Hecht JT, Tuan RS, Lawler J: Interaction of cartilage oligomeric matrix protein/thrombospondin 5 with aggrecan. J Biol Chem. 2007 Aug 24;282(34):24591-8. Epub 2007 Jun 22. [PubMed:17588949 ]
  12. Tompson SW, Merriman B, Funari VA, Fresquet M, Lachman RS, Rimoin DL, Nelson SF, Briggs MD, Cohn DH, Krakow D: A recessive skeletal dysplasia, SEMD aggrecan type, results from a missense mutation affecting the C-type lectin domain of aggrecan. Am J Hum Genet. 2009 Jan;84(1):72-9. doi: 10.1016/j.ajhg.2008.12.001. Epub 2008 Dec 24. [PubMed:19110214 ]