You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01922
Secondary Accession Numbers
  • 7330
Name Zinc finger protein 24
Synonyms
  1. RSG-A
  2. Retinoic acid suppression protein A
  3. Zinc finger and SCAN domain-containing protein 3
  4. Zinc finger protein 191
  5. Zinc finger protein KOX17
Gene Name ZNF24
Protein Type Unknown
Biological Properties
General Function Involved in viral reproduction
Specific Function Transcription factor required for myelination of differentiated oligodendrocytes. Required for the conversion of oligodendrocytes from the premyelinating to the myelinating state. In the developing central nervous system (CNS), involved in the maintenance in the progenitor stage by promoting the cell cycle. Specifically bind to the 5'-TCAT-3' DNA sequence. Has transcription repressor activity in vitro
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
intracellular
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
nucleic acid binding
sequence-specific dna binding transcription factor activity
Process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
regulation of transcription, dna-dependent
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:1
Locus 18q12
SNPs ZNF24
Gene Sequence
>1107 bp
ATGTCTGCACAGTCAGTGGAAGAAGATTCAATACTTATCATCCCAACTCCAGATGAAGAG
GAAAAAATTCTGAGAGTGAAGTTGGAGGAGGATCCTGATGGCGAAGAGGGATCAAGTATC
CCCTGGAACCATCTCCCAGACCCAGAGATTTTCCGACAGCGATTCAGGCAGTTTGGATAC
CAGGATTCACCTGGGCCCCGTGAGGCTGTGAGCCAGCTCCGAGAACTTTGCCGTCTGTGG
CTCAGGCCAGAGACGCACACAAAAGAACAAATCTTGGAGCTGGTAGTGCTGGAGCAGTTT
GTTGCCATCCTACCCAAAGAGCTACAGACTTGGGTTCGAGATCATCATCCAGAGAATGGA
GAGGAGGCAGTGACAGTGCTGGAGGATTTGGAGAGTGAACTTGATGACCCTGGACAACCG
GTTTCTCTCCGTCGACGAAAACGGGAAGTACTAGTAGAAGACATGGTATCTCAAGAAGAA
GCTCAGGGATTACCAAGTTCTGAGCTTGATGCTGTGGAGAACCAGCTCAAGTGGGCATCC
TGGGAGCTCCATTCCCTAAGGCACTGTGATGATGATGGTAGGACTGAAAATGGAGCACTA
GCTCCAAAGCAGGAGCTTCCTTCAGCATTAGAATCCCATGAAGTTCCTGGCACTCTCAAT
ATGGGTGTTCCTCAAATTTTTAAATATGGAGAAACCTGTTTCCCCAAGGGCAGGTTTGAA
AGAAAGAGAAATCCCTCTCGAAAGAAACAACATATATGTGATGAATGTGGAAAACACTTC
AGTCAGGGCTCAGCCCTTATTCTTCATCAAAGAATTCACAGTGGGGAGAAACCTTATGGA
TGTGTTGAGTGTGGGAAAGCATTCAGCCGAAGTTCCATTCTTGTGCAACACCAGAGAGTC
CACACTGGAGAAAAACCTTACAAATGTCTTGAATGTGGGAAAGCCTTTAGCCAGAATTCG
GGGCTTATTAATCATCAGAGAATCCATACTGGGGAGAAACCTTATGAATGCGTTCAGTGT
GGGAAATCGTATAGTCAAAGCTCAAATCTTTTTAGACATCAGAGAAGACACAATGCAGAA
AAACTTCTGAATGTTGTGAAAGTTTAA
Protein Properties
Number of Residues 368
Molecular Weight 42155.1
Theoretical pI 6.17
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Zinc finger protein 24
MSAQSVEEDSILIIPTPDEEEKILRVKLEEDPDGEEGSSIPWNHLPDPEIFRQRFRQFGY
QDSPGPREAVSQLRELCRLWLRPETHTKEQILELVVLEQFVAILPKELQTWVRDHHPENG
EEAVTVLEDLESELDDPGQPVSLRRRKREVLVEDMVSQEEAQGLPSSELDAVENQLKWAS
WELHSLRHCDDDGRTENGALAPKQELPSALESHEVPGTLNMGVPQIFKYGETCFPKGRFE
RKRNPSRKKQHICDECGKHFSQGSALILHQRIHSGEKPYGCVECGKAFSRSSILVQHQRV
HTGEKPYKCLECGKAFSQNSGLINHQRIHTGEKPYECVQCGKSYSQSSNLFRHQRRHNAE
KLLNVVKV
GenBank ID Protein 190610012
UniProtKB/Swiss-Prot ID P17028
UniProtKB/Swiss-Prot Entry Name ZNF24_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_006965.2
GeneCard ID ZNF24
GenAtlas ID ZNF24
HGNC ID HGNC:13032
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ: Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Nat Biotechnol. 2005 Jan;23(1):94-101. Epub 2004 Dec 12. [PubMed:15592455 ]
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  5. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  6. Nusbaum C, Zody MC, Borowsky ML, Kamal M, Kodira CD, Taylor TD, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Abouelleil A, Allen NR, Anderson S, Bloom T, Bugalter B, Butler J, Cook A, DeCaprio D, Engels R, Garber M, Gnirke A, Hafez N, Hall JL, Norman CH, Itoh T, Jaffe DB, Kuroki Y, Lehoczky J, Lui A, Macdonald P, Mauceli E, Mikkelsen TS, Naylor JW, Nicol R, Nguyen C, Noguchi H, O'Leary SB, O'Neill K, Piqani B, Smith CL, Talamas JA, Topham K, Totoki Y, Toyoda A, Wain HM, Young SK, Zeng Q, Zimmer AR, Fujiyama A, Hattori M, Birren BW, Sakaki Y, Lander ES: DNA sequence and analysis of human chromosome 18. Nature. 2005 Sep 22;437(7058):551-5. [PubMed:16177791 ]
  7. Han ZG, Zhang QH, Ye M, Kan LX, Gu BW, He KL, Shi SL, Zhou J, Fu G, Mao M, Chen SJ, Yu L, Chen Z: Molecular cloning of six novel Kruppel-like zinc finger genes from hematopoietic cells and identification of a novel transregulatory domain KRNB. J Biol Chem. 1999 Dec 10;274(50):35741-8. [PubMed:10585455 ]
  8. Thiesen HJ: Multiple genes encoding zinc finger domains are expressed in human T cells. New Biol. 1990 Apr;2(4):363-74. [PubMed:2288909 ]
  9. Gocke CB, Yu H, Kang J: Systematic identification and analysis of mammalian small ubiquitin-like modifier substrates. J Biol Chem. 2005 Feb 11;280(6):5004-12. Epub 2004 Nov 23. [PubMed:15561718 ]