You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01924
Secondary Accession Numbers
  • 7332
Name Cellular retinoic acid-binding protein 1
Synonyms
  1. CRABP-I
  2. Cellular retinoic acid-binding protein I
Gene Name CRABP1
Protein Type Transporter
Biological Properties
General Function Involved in binding
Specific Function Cytosolic CRABPs may regulate the access of retinoic acid to the nuclear retinoic acid receptors
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
transporter activity
lipid binding
Process
establishment of localization
transport
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 15q24
SNPs CRABP1
Gene Sequence
>414 bp
ATGCCCAACTTCGCCGGCACCTGGAAGATGCGCAGCAGCGAGAATTTCGACGAGCTGCTC
AAGGCACTGGGTGTGAACGCCATGCTGAGGAAAGTGGCCGTAGCGGCTGCGTCCAAGCCG
CACGTGGAGATCCGCCAGGACGGGGATCAGTTCTACATCAAGACATCCACCACGGTGCGC
ACCACTGAGATCAACTTCAAGGTCGGAGAAGGCTTTGAGGAGGAGACCGTGGACGGACGC
AAGTGCAGGAGTTTAGCCACTTGGGAGAATGAGAACAAGATCCACTGCACGCAAACTCTT
CTTGAAGGGGACGGCCCCAAAACCTACTGGACCAGTGAGCTGGCCAACGATGAACTTATC
CTGACGTTTGGCGCCGATGACGTGGTCTGCACCAGAATTTATGTCCGAGAGTGA
Protein Properties
Number of Residues 137
Molecular Weight 15565.4
Theoretical pI 5.03
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Cellular retinoic acid-binding protein 1
MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVR
TTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELI
LTFGADDVVCTRIYVRE
GenBank ID Protein 18314500
UniProtKB/Swiss-Prot ID P29762
UniProtKB/Swiss-Prot Entry Name RABP1_HUMAN
PDB IDs
GenBank Gene ID BC022069
GeneCard ID CRABP1
GenAtlas ID CRABP1
HGNC ID HGNC:2338
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  3. Eller MS, Oleksiak MF, McQuaid TJ, McAfee SG, Gilchrest BA: The molecular cloning and expression of two CRABP cDNAs from human skin. Exp Cell Res. 1992 Feb;198(2):328-36. [PubMed:1309505 ]
  4. Astrom A, Tavakkol A, Pettersson U, Cromie M, Elder JT, Voorhees JJ: Molecular cloning of two human cellular retinoic acid-binding proteins (CRABP). Retinoic acid-induced expression of CRABP-II but not CRABP-I in adult human skin in vivo and in skin fibroblasts in vitro. J Biol Chem. 1991 Sep 15;266(26):17662-6. [PubMed:1654334 ]
  5. Budhu AS, Noy N: Direct channeling of retinoic acid between cellular retinoic acid-binding protein II and retinoic acid receptor sensitizes mammary carcinoma cells to retinoic acid-induced growth arrest. Mol Cell Biol. 2002 Apr;22(8):2632-41. [PubMed:11909957 ]