Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01946
Secondary Accession Numbers
  • 7358
Name Very long-chain acyl-CoA synthetase
Synonyms
  1. FATP-2
  2. Fatty acid transport protein 2
  3. Fatty-acid-coenzyme A ligase, very long-chain 1
  4. Long-chain-fatty-acid--CoA ligase
  5. Solute carrier family 27 member 2
  6. THCA-CoA ligase
  7. VLACS
  8. VLCS
  9. Very long-chain-fatty-acid-CoA ligase
Gene Name SLC27A2
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Acyl-CoA synthetase probably involved in bile acid metabolism. Proposed to activate C27 precurors of bile acids to their CoA thioesters derivatives before side chain cleavage via peroxisomal beta-oxidation occurs. In vitro, activates 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholestanate (THCA), the C27 precursor of cholic acid deriving from the de novo synthesis from cholesterol. Does not utilize C24 bile acids as substrates. In vitro, also activates long- and branched-chain fatty acids and may have additional roles in fatty acid metabolism. May be involved in translocation of long-chain fatty acids (LFCA) across membranes (By similarity).
Pathways
  • Peroxisome
  • Phytanic Acid Peroxisomal Oxidation
  • PPAR signaling pathway
  • Refsum Disease
Reactions
Adenosine triphosphate + a long-chain fatty acid + Coenzyme A → Adenosine monophosphate + Pyrophosphate + an acyl-CoA details
Adenosine triphosphate + a very-long-chain carboxylic acid + Coenzyme A → Adenosine monophosphate + Pyrophosphate + an acyl-CoA details
GO Classification
Biological Process
bile acid biosynthetic process
fatty acid alpha-oxidation
methyl-branched fatty acid metabolic process
long-chain fatty acid import
fatty acid beta-oxidation
very long-chain fatty acid catabolic process
Cellular Component
mitochondrion
integral to endoplasmic reticulum membrane
endoplasmic reticulum lumen
integral to peroxisomal membrane
Function
catalytic activity
Molecular Function
fatty acid transporter activity
phytanate-CoA ligase activity
pristanate-CoA ligase activity
ATP binding
long-chain fatty acid-CoA ligase activity
very long-chain fatty acid-CoA ligase activity
Process
metabolic process
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Multi-pass membrane protein
  3. Multi-pass membrane protein
  4. Peroxisome membrane
Gene Properties
Chromosome Location 15
Locus 15q21.2
SNPs SLC27A2
Gene Sequence
>1863 bp
ATGCTTTCCGCCATCTACACAGTCCTGGCGGGACTGCTGTTCCTGCCGCTCCTGGTGAAC
CTCTGCTGCCCATACTTCTTCCAGGACATAGGCTACTTCTTGAAGGTGGCCGCCGTGGGC
CGGAGGGTGCGCAGCTACGGGAAGCGGCGGCCGGCGCGCACCATCCTGCGGGCGTTCCTG
GAGAAAGCGCGCCAGACGCCACACAAGCCTTTTCTGCTCTTCCGCGACGAGACTCTCACC
TACGCGCAGGTGGACCGGCGCAGCAATCAAGTGGCCCGGGCGCTGCACGACCACCTCGGC
CTGCGCCAGGGAGACTGCGTGGCGCTCCTTATGGGTAACGAGCCGGCCTACGTGTGGCTG
TGGCTGGGGCTGGTGAAGCTGGGCTGTGCCATGGCGTGCCTCAATTACAACATCCGCGCG
AAGTCCCTGCTGCACTGCTTCCAGTGCTGCGGGGCGAAGGTGCTGCTGGTGTCGCCAGAA
CTACAAGCAGCTGTCGAAGAGATACTGCCAAGCCTTAAAAAAGATGATGTGTCCATCTAT
TATGTGAGCAGAACTTCTAACACAGATGGGATTGACTCTTTCCTGGACAAAGTGGATGAA
GTATCAACTGAACCTATCCCAGAGTCATGGAGGTCTGAAGTCACTTTTTCCACTCCTGCC
TTATACATTTATACTTCTGGAACCACAGGTCTTCCAAAAGCAGCCATGATCACTCATCAG
CGCATATGGTATGGAACTGGCCTCACTTTTGTAAGCGGATTGAAGGCAGATGATGTCATC
TATATCACTCTGCCCTTTTACCACAGTGCTGCACTACTGATTGGCATTCACGGATGTATT
GTGGCTGGTGCTACTCTTGCCTTGCGGACTAAATTTTCAGCCAGCCAGTTTTGGGATGAC
TGCAGAAAATACAACGTCACTGTCATTCAGTATATCGGTGAACTGCTTCGGTATTTATGC
AACTCACCACAGAAACCAAATGACCGTGATCATAAAGTGAGACTGGCACTGGGAAATGGC
TTACGAGGAGATGTGTGGAGACAATTTGTCAAGAGATTTGGGGACATATGCATCTATGAG
TTCTATGCTGCCACTGAAGGCAATATTGGATTTATGAATTATGCGAGAAAAGTTGGTGCT
GTTGGAAGAGTAAACTACCTACAGAAAAAAATCATAACTTATGACCTGATTAAATATGAT
GTGGAGAAAGATGAACCTGTCCGTGATGAAAATGGATATTGCGTCAGAGTTCCCAAAGGT
GAAGTTGGACTTCTGGTTTGCAAAATCACACAACTTACACCATTTAATGGCTATGCTGGA
GCAAAGGCTCAGACAGAGAAGAAAAAACTGAGAGATGTCTTTAAGAAAGGAGACCTCTAT
TTCAACAGTGGAGATCTCTTAATGGTTGACCATGAAAATTTCATCTATTTCCACGACAGA
GTTGGAGATACATTCCGGTGGAAAGGGGAAAATGTGGCCACCACTGAAGTTGCTGATACA
GTTGGACTGGTTGATTTTGTCCAAGAAGTAAATGTTTATGGAGTGCATGTGCCAGATCAT
GAGGGTCGCATTGGCATGGCCTCCATCAAAATGAAAGAAAACCATGAATTTGATGGAAAG
AAACTCTTTCAGCACATTGCTGATTACCTACCTAGTTATGCAAGGCCCCGGTTTCTAAGA
ATACAGGACACCATTGAGATCACTGGAACTTTTAAACACCGCAAAATGACCCTGGTGGAG
GAGGGCTTTAACCCTGCTGTCATCAAAGATGCCTTGTATTTCTTGGATGACACAGCAAAA
ATGTATGTGCCTATGACTGAGGACATCTATAATGCCATAAGTGCTAAAACCCTGAAACTC
TGA
Protein Properties
Number of Residues 620
Molecular Weight 64614.99
Theoretical pI 8.48
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Very long-chain acyl-CoA synthetase
MLSAIYTVLAGLLFLPLLVNLCCPYFFQDIGYFLKVAAVGRRVRSYGKRRPARTILRAFL
EKARQTPHKPFLLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWL
WLGLVKLGCAMACLNYNIRAKSLLHCFQCCGAKVLLVSPELQAAVEEILPSLKKDDVSIY
YVSRTSNTDGIDSFLDKVDEVSTEPIPESWRSEVTFSTPALYIYTSGTTGLPKAAMITHQ
RIWYGTGLTFVSGLKADDVIYITLPFYHSAALLIGIHGCIVAGATLALRTKFSASQFWDD
CRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFVKRFGDICIYE
FYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKG
EVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDR
VGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEFDGK
KLFQHIADYLPSYARPRFLRIQDTIEITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAK
MYVPMTEDIYNAISAKTLKL
GenBank ID Protein 227499619
UniProtKB/Swiss-Prot ID O14975
UniProtKB/Swiss-Prot Entry Name S27A2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_003645.3
GeneCard ID SLC27A2
GenAtlas ID SLC27A2
HGNC ID HGNC:10996
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. [PubMed:16572171 ]
  4. Steinberg SJ, Wang SJ, Kim DG, Mihalik SJ, Watkins PA: Human very-long-chain acyl-CoA synthetase: cloning, topography, and relevance to branched-chain fatty acid metabolism. Biochem Biophys Res Commun. 1999 Apr 13;257(2):615-21. [PubMed:10198260 ]
  5. Mihalik SJ, Steinberg SJ, Pei Z, Park J, Kim DG, Heinzer AK, Dacremont G, Wanders RJ, Cuebas DA, Smith KD, Watkins PA: Participation of two members of the very long-chain acyl-CoA synthetase family in bile acid synthesis and recycling. J Biol Chem. 2002 Jul 5;277(27):24771-9. Epub 2002 Apr 29. [PubMed:11980911 ]