You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01947
Secondary Accession Numbers
  • 7361
Name Ammonium transporter Rh type A
Synonyms
  1. CD241 antigen
  2. Erythrocyte membrane glycoprotein Rh50
  3. Erythrocyte plasma membrane 50 kDa glycoprotein
  4. Rh family type A glycoprotein
  5. Rh type A glycoprotein
  6. Rh50A
  7. Rhesus blood group family type A glycoprotein
  8. Rhesus blood group-associated ammonia channel
  9. Rhesus blood group-associated glycoprotein
Gene Name RHAG
Protein Type Enzyme
Biological Properties
General Function Involved in ammonium transmembrane transporter activity
Specific Function Associated with rhesus blood group antigen expression. May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
small molecule metabolic process
bicarbonate transport
carbon dioxide transport
cellular ion homeostasis
Cellular Component
integral to plasma membrane
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
transporter activity
organic cation transmembrane transporter activity
ammonium transmembrane transporter activity
Molecular Function
ammonia transmembrane transporter activity
ammonium transmembrane transporter activity
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 6
Locus 6p12.3
SNPs RHAG
Gene Sequence
>1230 bp
ATGAGGTTCACATTCCCTCTCATGGCTATAGTCCTGGAAATTGCCATGATTGTTTTATTT
GGATTATTTGTTGAGTATGAAACGGACCAGACTGTTCTCGAGCAGCTCAACATCACCAAG
CCAACAGACATGGGCATATTCTTTGAGTTATATCCTCTGTTCCAAGATGTACATGTTATG
ATATTTGTTGGGTTTGGCTTCCTCATGACCTTCCTGAAGAAATATGGCTTCAGCAGTGTG
GGTATCAACCTACTCGTTGCTGCTTTGGGCCTCCAGTGGGGCACTATTGTACAGGGAATC
CTGCAAAGCCAGGGACAGAAATTTAACATTGGAATCAAAAACATGATAAATGCAGACTTC
AGTGCAGCCACAGTTCTGATATCTTTTGGAGCTGTCCTGGGAAAAACGAGCCCCACCCAA
ATGCTGATCATGACAATTTTAGAAATTGTTTTCTTTGCCCACAATGAATACCTGGTTAGT
GAAATATTTAAGGCCTCTGACATTGGAGCATCAATGACGATCCATGCCTTTGGGGCCTAC
TTTGGCTTGGCTGTAGCAGGCATCTTGTATCGATCTGGACTGAGAAAGGGGCATGAAAAT
GAAGAGTCCGCATACTACTCAGACTTGTTTGCAATGATTGGGACTCTCTTTCTGTGGATG
TTTTGGCCCAGCTTTAACTCGGCCATTGCTGAACCTGGAGACAAACAGTGCAGGGCCATT
GTAAACACGTACTTCTCTCTCGCTGCCTGTGTGCTCACAGCCTTTGCCTTCTCCAGCCTA
GTGGAGCACCGAGGCAAGCTCAACATGGTTCACATTCAGAATGCCACCCTTGCTGGAGGA
GTTGCTGTGGGCACTTGTGCGGATATGGCAATTCACCCATTTGGTTCTATGATTATTGGG
AGCATTGCAGGAATGGTCTCTGTGCTTGGATACAAGTTCCTGACTCCACTTTTTACTACT
AAACTGAGGATCCATGATACATGTGGGGTCCATAACCTCCACGGCTTACCTGGTGTAGTG
GGAGGCCTTGCAGGCATTGTGGCAGTAGCAATGGGCGCCTCCAACACGTCTATGGCCATG
CAGGCAGCTGCACTGGGTTCCTCTATCGGAACAGCAGTTGTTGGAGGTCTGATGACAGGT
TTAATTCTAAAGTTGCCTCTCTGGGGACAGCCATCTGACCAGAACTGCTATGATGATTCT
GTTTATTGGAAGGTCCCTAAGACGAGATAA
Protein Properties
Number of Residues 409
Molecular Weight 44197.55
Theoretical pI 6.847
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Ammonium transporter Rh type A
MRFTFPLMAIVLEIAMIVLFGLFVEYETDQTVLEQLNITKPTDMGIFFELYPLFQDVHVM
IFVGFGFLMTFLKKYGFSSVGINLLVAALGLQWGTIVQGILQSQGQKFNIGIKNMINADF
SAATVLISFGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFGAY
FGLAVAGILYRSGLRKGHENEESAYYSDLFAMIGTLFLWMFWPSFNSAIAEPGDKQCRAI
VNTYFSLAACVLTAFAFSSLVEHRGKLNMVHIQNATLAGGVAVGTCADMAIHPFGSMIIG
SIAGMVSVLGYKFLTPLFTTKLRIHDTCGVHNLHGLPGVVGGLAGIVAVAMGASNTSMAM
QAAALGSSIGTAVVGGLMTGLILKLPLWGQPSDQNCYDDSVYWKVPKTR
GenBank ID Protein 2909819
UniProtKB/Swiss-Prot ID Q02094
UniProtKB/Swiss-Prot Entry Name RHAG_HUMAN
PDB IDs Not Available
GenBank Gene ID AF031548
GeneCard ID RHAG
GenAtlas ID RHAG
HGNC ID HGNC:10006
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  3. Ridgwell K, Spurr NK, Laguda B, MacGeoch C, Avent ND, Tanner MJ: Isolation of cDNA clones for a 50 kDa glycoprotein of the human erythrocyte membrane associated with Rh (rhesus) blood-group antigen expression. Biochem J. 1992 Oct 1;287 ( Pt 1):223-8. [PubMed:1417776 ]
  4. Huang CH: The human Rh50 glycoprotein gene. Structural organization and associated splicing defect resulting in Rh(null) disease. J Biol Chem. 1998 Jan 23;273(4):2207-13. [PubMed:9442063 ]
  5. Iwamoto S, Omi T, Yamasaki M, Okuda H, Kawano M, Kajii E: Identification of 5' flanking sequence of RH50 gene and the core region for erythroid-specific expression. Biochem Biophys Res Commun. 1998 Feb 4;243(1):233-40. [PubMed:9473510 ]
  6. Avent ND, Ridgwell K, Mawby WJ, Tanner MJ, Anstee DJ, Kumpel B: Protein-sequence studies on Rh-related polypeptides suggest the presence of at least two groups of proteins which associate in the human red-cell membrane. Biochem J. 1988 Dec 15;256(3):1043-6. [PubMed:3146980 ]
  7. Marini AM, Matassi G, Raynal V, Andre B, Cartron JP, Cherif-Zahar B: The human Rhesus-associated RhAG protein and a kidney homologue promote ammonium transport in yeast. Nat Genet. 2000 Nov;26(3):341-4. [PubMed:11062476 ]
  8. Westhoff CM, Ferreri-Jacobia M, Mak DO, Foskett JK: Identification of the erythrocyte Rh blood group glycoprotein as a mammalian ammonium transporter. J Biol Chem. 2002 Apr 12;277(15):12499-502. Epub 2002 Feb 22. [PubMed:11861637 ]
  9. Westhoff CM, Siegel DL, Burd CG, Foskett JK: Mechanism of genetic complementation of ammonium transport in yeast by human erythrocyte Rh-associated glycoprotein. J Biol Chem. 2004 Apr 23;279(17):17443-8. Epub 2004 Feb 13. [PubMed:14966114 ]
  10. Cherif-Zahar B, Raynal V, Gane P, Mattei MG, Bailly P, Gibbs B, Colin Y, Cartron JP: Candidate gene acting as a suppressor of the RH locus in most cases of Rh-deficiency. Nat Genet. 1996 Feb;12(2):168-73. [PubMed:8563755 ]
  11. Hyland CA, Cherif-Zahar B, Cowley N, Raynal V, Parkes J, Saul A, Cartron JP: A novel single missense mutation identified along the RH50 gene in a composite heterozygous Rhnull blood donor of the regulator type. Blood. 1998 Feb 15;91(4):1458-63. [PubMed:9454778 ]
  12. Huang CH, Liu Z, Cheng G, Chen Y: Rh50 glycoprotein gene and rhnull disease: a silent splice donor is trans to a Gly279-->Glu missense mutation in the conserved transmembrane segment. Blood. 1998 Sep 1;92(5):1776-84. [PubMed:9716608 ]
  13. Huang CH, Cheng G, Liu Z, Chen Y, Reid ME, Halverson G, Okubo Y: Molecular basis for Rh(null) syndrome: identification of three new missense mutations in the Rh50 glycoprotein gene. Am J Hematol. 1999 Sep;62(1):25-32. [PubMed:10467273 ]