You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01987
Secondary Accession Numbers
  • 7425
Name Apolipoprotein C-III precursor
Synonyms
  1. Apo-CIII
  2. ApoC-III
Gene Name APOC3
Protein Type Transporter
Biological Properties
General Function Not Available
Specific Function Inhibits lipoprotein lipase and hepatic lipase and decreases the uptake of lymph chylomicrons by hepatic cells. This suggests that it delays the catabolism of triglyceride-rich particles
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region
Function
binding
lipid binding
Process
lipoprotein metabolism
transport
physiological process
metabolism
macromolecule metabolism
protein metabolism
cellular protein metabolism
cellular physiological process
lipid transport
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:11
Locus 11q23.1-q23.2
SNPs APOC3
Gene Sequence
>300 bp
ATGCAGCCCCGGGTACTCCTTGTTGTTGCCCTCCTGGCGCTCCTGGCCTCTGCCCGAGCT
TCAGAGGCCGAGGATGCCTCCCTTCTCAGCTTCATGCAGGGCTACATGAAGCACGCCACC
AAGACCGCCAAGGATGCACTGAGCAGCGTGCAGGAGTCCCAGGTGGCCCAGCAGGCCAGG
GGCTGGGTGACCGATGGCTTCAGTTCCCTGAAAGACTACTGGAGCACCGTTAAGGACAAG
TTCTCTGAGTTCTGGGATTTGGACCCTGAGGTCAGACCAACTTCAGCCGTGGCTGCCTGA
Protein Properties
Number of Residues 99
Molecular Weight 10852.0
Theoretical pI 5.04
Pfam Domain Function
Signals
  • 1-20
Transmembrane Regions Not Available
Protein Sequence
>Apolipoprotein C-III precursor
MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQAR
GWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
GenBank ID Protein 178768
UniProtKB/Swiss-Prot ID P02656
UniProtKB/Swiss-Prot Entry Name APOC3_HUMAN
PDB IDs Not Available
GenBank Gene ID J00098
GeneCard ID APOC3
GenAtlas ID APOC3
HGNC ID HGNC:610
References
General References
  1. Sharpe CR, Sidoli A, Shelley CS, Lucero MA, Shoulders CC, Baralle FE: Human apolipoproteins AI, AII, CII and CIII. cDNA sequences and mRNA abundance. Nucleic Acids Res. 1984 May 11;12(9):3917-32. [PubMed:6328445 ]
  2. Protter AA, Levy-Wilson B, Miller J, Bencen G, White T, Seilhamer JJ: Isolation and sequence analysis of the human apolipoprotein CIII gene and the intergenic region between the apo AI and apo CIII genes. DNA. 1984 Dec;3(6):449-56. [PubMed:6439535 ]
  3. Levy-Wilson B, Appleby V, Protter A, Auperin D, Seilhamer JJ: Isolation and DNA sequence of full-length cDNA for human preapolipoprotein CIII. DNA. 1984 Oct;3(5):359-64. [PubMed:6548954 ]
  4. Karathanasis SK, Zannis VI, Breslow JL: Isolation and characterization of cDNA clones corresponding to two different human apoC-III alleles. J Lipid Res. 1985 Apr;26(4):451-6. [PubMed:2989400 ]
  5. Hospattankar AV, Brewer HB Jr, Ronan R, Fairwell T: Amino acid sequence of human plasma apolipoprotein C-III from normolipidemic subjects. FEBS Lett. 1986 Mar 3;197(1-2):67-73. [PubMed:3949020 ]
  6. Brewer HB Jr, Shulman R, Herbert P, Ronan R, Wehrly K: The complete amino acid sequence of alanine apolipoprotein (apoC-3), and apolipoprotein from human plasma very low density lipoproteins. J Biol Chem. 1974 Aug 10;249(15):4975-84. [PubMed:4846755 ]
  7. Maeda H, Hashimoto RK, Ogura T, Hiraga S, Uzawa H: Molecular cloning of a human apoC-III variant: Thr 74----Ala 74 mutation prevents O-glycosylation. J Lipid Res. 1987 Dec;28(12):1405-9. [PubMed:3123586 ]
  8. von Eckardstein A, Holz H, Sandkamp M, Weng W, Funke H, Assmann G: Apolipoprotein C-III(Lys58----Glu). Identification of an apolipoprotein C-III variant in a family with hyperalphalipoproteinemia. J Clin Invest. 1991 May;87(5):1724-31. [PubMed:2022742 ]