You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01996
Secondary Accession Numbers
  • 7441
Name Transcobalamin-1
Synonyms
  1. TC I
  2. TC-1
  3. TCI
  4. Transcobalamin I
Gene Name TCN1
Protein Type Transporter
Biological Properties
General Function Involved in cobalamin binding
Specific Function Vitamin B12-binding protein. Transports cobalamin into cells
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
cobalamin binding
vitamin binding
Process
establishment of localization
transport
vitamin transport
cobalamin transport
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:1
Locus 11q11-q12
SNPs TCN1
Gene Sequence
>1302 bp
ATGAGACAGTCACACCAGCTGCCCCTAGTGGGGCTCTTACTGTTTTCTTTTATTCCAAGC
CAACTATGCGAGATTTGTGAGGTAAGTGAAGAAAACTACATCCGCCTAAAACCTCTGTTG
AATACAATGATCCAGTCAAACTATAACAGGGGAACCAGCGCTGTCAATGTTGTGTTGTCC
CTCAAACTTGTTGGAATCCAGATCCAAACCCTGATGCAAAAGATGATCCAACAAATCAAA
TACAATGTGAAAAGCAGATTGTCAGATGTAAGCTCGGGAGAGCTTGCCTTGATTATACTG
GCTTTGGGAGTATGTCGTAACGCTGAGGAAAACTTAATATATGATTACCACCTGACTGAC
AAGCTAGAAAATAAATTCCAAGCAGAAATTGAAAATATGGAAGCACACAATGGCACTCCC
CTGACTAACTACTACCAGCTCAGCCTGGACGTTTTGGCCTTGTGTCTGTTCAATGGGAAC
TACTCAACCGCCGAAGTTGTCAACCACTTCACTCCTGAAAATAAAAACTATTATTTTGGT
AGCCAGTTCTCAGTAGATACTGGTGCAATGGCTGTCCTGGCTCTGACCTGTGTGAAGAAG
AGTCTAATAAATGGGCAGATCAAAGCAGATGAAGGCAGTTTAAAGAACATCAGTATTTAT
ACAAAGTCACTGGTAGAAAAGATTCTGTCTGAGAAAAAAGAAAATGGTCTCATTGGAAAC
ACATTTAGCACAGGAGAAGCCATGCAGGCCCTCTTTGTATCATCAGACTATTATAATGAA
AATGACTGGAATTGCCAACAAACTCTGAATACAGTGCTCACGGAAATTTCTCAAGGAGCA
TTCAGTAATCCAAACGCTGCAGCCCAGGTCTTACCTGCCCTGATGGGAAAGACCTTCTTG
GATATTAACAAAGACTCTTCTTGCGTCTCTGCTTCAGGTAACTTCAACATCTCCGCTGAT
GAGCCTATAACTGTGACACCTCCTGACTCACAATCATATATCTCCGTCAATTACTCTGTG
AGAATCAATGAAACATATTTCACCAATGTCACTGTGCTAAATGGTTCTGTCTTCCTCAGT
GTGATGGAGAAAGCCCAGAAAATGAATGATACTATATTTGGTTTCACAATGGAGGAGCGC
TCATGGGGGCCCTATATCACCTGTATTCAGGGCCTATGTGCCAACAATAATGACAGAACC
TACTGGGAACTTCTGAGTGGAGGCGAACCACTGAGCCAAGGAGCTGGTAGTTACGTTGTC
CGCAATGGAGAAAACTTGGAGGTTCGCTGGAGCAAATACTAA
Protein Properties
Number of Residues 433
Molecular Weight 48206.3
Theoretical pI 4.68
Pfam Domain Function
Signals
  • 1-23
Transmembrane Regions
  • None
Protein Sequence
>Transcobalamin-1
MRQSHQLPLVGLLLFSFIPSQLCEICEVSEENYIRLKPLLNTMIQSNYNRGTSAVNVVLS
LKLVGIQIQTLMQKMIQQIKYNVKSRLSDVSSGELALIILALGVCRNAEENLIYDYHLID
KLENKFQAEIENMEAHNGTPLTNYYQLSLDVLALCLFNGNYSTAEVVNHFTPENKNYYFG
SQFSVDTGAMAVLALTCVKKSLINGQIKADEGSLKNISIYTKSLVEKILSEKKENGLIGN
TFSTGEAMQALFVSSDYYNENDWNCQQTLNTVLTEISQGAFSNPNAAAQVLPALMGKTFL
DINKDSSCVSASGNFNISADEPITVTPPDSQSYISVNYSVRINETYFTNVTVLNGSVFLS
VMEKAQKMNDTIFGFTMEERSWGPYITCIQGLCANNNDRTYWELLSGGEPLSQGAGSYVV
RNGENLEVRWSKY
GenBank ID Protein 307479
UniProtKB/Swiss-Prot ID P20061
UniProtKB/Swiss-Prot Entry Name TCO1_HUMAN
PDB IDs Not Available
GenBank Gene ID J05068
GeneCard ID TCN1
GenAtlas ID TCN1
HGNC ID HGNC:11652
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811 ]
  3. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952 ]
  4. Ramachandran P, Boontheung P, Xie Y, Sondej M, Wong DT, Loo JA: Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry. J Proteome Res. 2006 Jun;5(6):1493-503. [PubMed:16740002 ]
  5. Johnston J, Bollekens J, Allen RH, Berliner N: Structure of the cDNA encoding transcobalamin I, a neutrophil granule protein. J Biol Chem. 1989 Sep 25;264(27):15754-7. [PubMed:2777761 ]