You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02021
Secondary Accession Numbers
  • 7479
  • HMDBP05654
Name Solute carrier organic anion transporter family member 2B1
Synonyms
  1. OATP-B
  2. OATP-RP2
  3. OATPRP2
  4. Organic anion transporter B
  5. Organic anion transporter polypeptide-related protein 2
  6. Solute carrier family 21 member 9
Gene Name SLCO2B1
Protein Type Transporter
Biological Properties
General Function Involved in transporter activity
Specific Function Mediates the Na(+)-independent transport of organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transporter activity
Process
establishment of localization
transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 11q13
SNPs SLCO2B1
Gene Sequence
>2130 bp
ATGGGACCCAGGATAGGGCCAGCGGGTGAGGTACCCCAGGTACCAGACAAGGAAACCAAA
GCCACAATGGGCACAGAAAACACACCTGGAGGCAAAGCCAGCCCAGACCCTCAGGACGTG
CGGCCAAGTGTGTTCCATAACATCAAGCTGTTCGTTCTGTGCCACAGCCTGCTGCAGCTG
GCGCAGCTCATGATCTCCGGCTACCTAAAGAGCTCCATCTCCACAGTGGAGAAGCGCTTC
GGCCTCTCCAGCCAGACGTCGGGGCTGCTGGCCTCCTTCAACGAGGTGGGGAACACAGCC
TTGATTGTGTTTGTGAGCTATTTTGGCAGCCGGGTGCACCGACCCCGAATGATTGGCTAT
GGGGCTATCCTTGTGGCCCTGGCGGGCCTGCTCATGACTCTCCCGCACTTCATCTCGGAG
CCATACCGCTACGACAACACCAGCCCTGAGGATATGCCACAGGACTTCAAGGCTTCCCTG
TGCCTGCCCACAACCTCGGCCCCAGCCTCGGCCCCCTCCAATGGCAACTGCTCAAGCTAC
ACAGAAACCCAGCATCTGAGTGTGGTGGGGATCATGTTCGTGGCACAGACCCTGCTGGGC
GTGGGCGGGGTGCCCATTCAGCCCTTTGGCATCTCCTACATCGATGACTTTGCCCACAAC
AGCAACTCGCCCCTCTACCTCGGGATCCTGTTTGCAGTGACCATGATGGGGCCAGGCCTG
GCCTTTGGGCTGGGCAGCCTCATGCTGCGCCTTTATGTGGACATTAACCAGATGCCAGAA
GGTGGTATCAGCCTGACCATAAAGGACCCCCGATGGGTGGGTGCCTGGTGGCTGGGTTTC
CTCATCGCTGCCGGTGCAGTGGCCCTGGCTGCCATCCCCTACTTCTTCTTCCCCAAGGAA
ATGCCCAAGGAAAAACGTGAGCTTCAGTTTCGGCGAAAGGTCTTAGCAGTCACAGACTCA
CCTGCCAGGAAGGGCAAGGACTCTCCCTCTAAGCAGAGCCCTGGGGAGTCCACGAAGAAG
CAGGATGGCCTAGTCCAGATTGCACCAAACCTGACTGTGATCCAGTTCATTAAAGTCTTC
CCCAGGGTGCTGCTGCAGACCCTACGCCACCCCATCTTCCTGCTGGTGGTCCTGTCCCAG
GTATGCTTGTCATCCATGGCTGCGGGCATGGCCACCTTCCTGCCCAAGTTCCTGGAGCGC
CAGTTTTCCATCACAGCCTCCTACGCCAACCTGCTCATCGGCTGCCTCTCCTTCCCTTCG
GTCATCGTGGGCATCGTGGTGGGTGGCGTCCTGGTCAAGCGGCTCCACCTGGGCCCTGTG
GGATGCGGTGCCCTTTGCCTGCTGGGGATGCTGCTGTGCCTCTTCTTCAGCCTGCCGCTC
TTCTTTATCGGCTGCTCCAGCCACCAGATTGCGGGCATCACACACCAGACCAGTGCCCAC
CCTGGGCTGGAGCTGTCTCCAAGCTGCATGGAGGCCTGCTCCTGCCCATTGGACGGCTTT
AACCCTGTCTGCGACCCCAGCACTCGTGTGGAATACATCACACCCTGCCACGCAGGCTGC
TCAAGCTGGGTGGTCCAGGATGCTCTGGACAACAGCCAGGTTTTCTACACCAACTGCAGC
TGCGTGGTGGAGGGCAACCCCGTGCTGGCAGGATCCTGCGACTCAACGTGCAGCCATCTG
GTGGTGCCCTTCCTGCTCCTGGTCAGCCTGGGCTCGGCCCTGGCCTGTCTCACCCACACA
CCCTCCTTCATGCTCATCCTAAGAGGAGTGAAGAAAGAAGACAAGACTTTGGCTGTGGGC
ATCCAGTTCATGTTCCTGAGGATTTTGGCCTGGATGCCCAGCCCCGTGATCCACGGCAGC
GCCATCGACACCACCTGTGTGCACTGGGCCCTGAGCTGTGGGCGTCGAGCTGTCTGTCGC
TACTACAATAATGACCTGCTCCGAAACCGGTTCATCGGCCTCCAGTTCTTCTTCAAAACA
GGTTCTGTGATCTGCTTCGCCTTAGTTTTGGCTGTCCTGAGGCAGCAGGACAAAGAGGCA
AGGACCAAAGAGAGCAGATCCAGCCCTGCCGTAGAGCAGCAATTGCTAGTGTCGGGGCCA
GGGAAGAAGCCAGAGGATTCCCGAGTGTGA
Protein Properties
Number of Residues 709
Molecular Weight 76697.9
Theoretical pI 8.39
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 118-138
  • 186-206
  • 225-245
  • 277-297
  • 371-391
  • 412-432
  • 443-463
  • 557-577
  • 597-617
  • 651-671
Protein Sequence
>Solute carrier organic anion transporter family member 2B1
MGPRIGPAGEVPQVPDKETKATMGTENTPGGKASPDPQDVRPSVFHNIKLFVLCHSLLQL
AQLMISGYLKSSISTVEKRFGLSSQTSGLLASFNEVGNTALIVFVSYFGSRVHRPRMIGY
GAILVALAGLLMTLPHFISEPYRYDNTSPEDMPQDFKASLCLPTTSAPASAPSNGNCSSY
TETQHLSVVGIMFVAQTLLGVGGVPIQPFGISYIDDFAHNSNSPLYLGILFAVTMMGPGL
AFGLGSLMLRLYVDINQMPEGGISLTIKDPRWVGAWWLGFLIAAGAVALAAIPYFFFPKE
MPKEKRELQFRRKVLAVTDSPARKGKDSPSKQSPGESTKKQDGLVQIAPNLTVIQFIKVF
PRVLLQTLRHPIFLLVVLSQVCLSSMAAGMATFLPKFLERQFSITASYANLLIGCLSFPS
VIVGIVVGGVLVKRLHLGPVGCGALCLLGMLLCLFFSLPLFFIGCSSHQIAGITHQTSAH
PGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCS
CVVEGNPVLAGSCDSTCSHLVVPFLLLVSLGSALACLTHTPSFMLILRGVKKEDKTLAVG
IQFMFLRILAWMPSPVIHGSAIDTTCVHWALSCGRRAVCRYYNNDLLRNRFIGLQFFFKT
GSVICFALVLAVLRQQDKEARTKESRSSPAVEQQLLVSGPGKKPEDSRV
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O94956
UniProtKB/Swiss-Prot Entry Name SO2B1_HUMAN
PDB IDs Not Available
GenBank Gene ID AB026256
GeneCard ID SLCO2B1
GenAtlas ID SLCO2B1
HGNC ID HGNC:10962
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  3. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  4. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811 ]
  5. Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Dec 31;5(6):355-64. [PubMed:10048485 ]