You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02068
Secondary Accession Numbers
  • 7548
Name Parathyroid hormone
Synonyms
  1. PTH
  2. Parathormone
  3. Parathyrin
Gene Name PTH
Protein Type Unknown
Biological Properties
General Function Involved in hormone activity
Specific Function PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region
Function
hormone activity
binding
protein binding
receptor binding
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:1
Locus 11p15.3-p15.1
SNPs PTH
Gene Sequence
>348 bp
ATGATACCTGCAAAAGACATGGCTAAAGTTATGATTGTCATGTTGGCAATTTGTTTTCTT
ACAAAATCGGATGGGAAATCTGTTAAGAAGAGATCTGTGAGTGAAATACAGCTTATGCAT
AACCTGGGAAAACATCTGAACTCGATGGAGAGAGTAGAATGGCTGCGTAAGAAGCTGCAG
GATGTGCACAATTTTGTTGCCCTTGGAGCTCCTCTAGCTCCCAGAGATGCTGGTTCCCAG
AGGCCCCGAAAAAAGGAAGACAATGTCTTGGTTGAGAGCCATGAAAAAAGTCTTGGAGAG
GCAGACAAAGCTGATGTGAATGTATTAACTAAAGCTAAATCCCAGTGA
Protein Properties
Number of Residues 115
Molecular Weight 12861.0
Theoretical pI 10.49
Pfam Domain Function
Signals
  • 1-25
Transmembrane Regions
  • None
Protein Sequence
>Parathyroid hormone
MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQ
DVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
GenBank ID Protein 37144
UniProtKB/Swiss-Prot ID P01270
UniProtKB/Swiss-Prot Entry Name PTHY_HUMAN
PDB IDs
GenBank Gene ID V00597
GeneCard ID PTH
GenAtlas ID PTH
HGNC ID HGNC:9606
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Zhang Z, Henzel WJ: Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 2004 Oct;13(10):2819-24. Epub 2004 Aug 31. [PubMed:15340161 ]
  3. Hendy GN, Kronenberg HM, Potts JT Jr, Rich A: Nucleotide sequence of cloned cDNAs encoding human preproparathyroid hormone. Proc Natl Acad Sci U S A. 1981 Dec;78(12):7365-9. [PubMed:6950381 ]
  4. Vasicek TJ, McDevitt BE, Freeman MW, Fennick BJ, Hendy GN, Potts JT Jr, Rich A, Kronenberg HM: Nucleotide sequence of the human parathyroid hormone gene. Proc Natl Acad Sci U S A. 1983 Apr;80(8):2127-31. [PubMed:6220408 ]
  5. Karaplis AC, Lim SK, Baba H, Arnold A, Kronenberg HM: Inefficient membrane targeting, translocation, and proteolytic processing by signal peptidase of a mutant preproparathyroid hormone protein. J Biol Chem. 1995 Jan 27;270(4):1629-35. [PubMed:7829495 ]
  6. Jacobs JW, Kemper B, Niall HD, Habener JF, Potts JT Jr: Structural analysis of human proparathyroid hormone by a new microsequencing approach. Nature. 1974 May 10;249(453):155-7. [PubMed:4833516 ]
  7. Niall HD, Sauer RT, Jacobs JW, Keutmann HT, Segre GV, O'Riordan JL, Aurbach GD, Potts JT Jr: The amino-acid sequence of the amino-terminal 37 residues of human parathyroid hormone. Proc Natl Acad Sci U S A. 1974 Feb;71(2):384-8. [PubMed:4521809 ]
  8. Keutmann HT, Sauer MM, Hendy GN, O'Riordan LH, Potts JT Jr: Complete amino acid sequence of human parathyroid hormone. Biochemistry. 1978 Dec 26;17(26):5723-9. [PubMed:728431 ]
  9. Keutmann HT, Niall HD, O'Riordan JL, Potts JT Jr: A reinvestigation of the amino-terminal sequence of human parathyroid hormone. Biochemistry. 1975 May 6;14(9):1842-7. [PubMed:1125201 ]
  10. Tregear GW, van Rietschoten J, Greene E, Niall HD, Keutmann HT, Parsons JA, O'Riordan JL, Potts JT Jr: Solid-phase synthesis of the biologically active N-terminal 1 - 34 peptide of human parathyroid hormone. Hoppe Seylers Z Physiol Chem. 1974 Apr;355(4):415-21. [PubMed:4474131 ]
  11. Andreatta RH, Hartmann A, Johl A, Kamber B, Maier R, Riniker B, Rittel W, Sieber P: [Synthesis of sequence 1-34 of human parathyroid hormone]. Helv Chim Acta. 1973;56(1):470-3. [PubMed:4721748 ]
  12. Klaus W, Dieckmann T, Wray V, Schomburg D, Wingender E, Mayer H: Investigation of the solution structure of the human parathyroid hormone fragment (1-34) by 1H NMR spectroscopy, distance geometry, and molecular dynamics calculations. Biochemistry. 1991 Jul 16;30(28):6936-42. [PubMed:2069952 ]
  13. Barden JA, Cuthbertson RM: Stabilized NMR structure of human parathyroid hormone(1-34). Eur J Biochem. 1993 Jul 15;215(2):315-21. [PubMed:8344299 ]
  14. Marx UC, Austermann S, Bayer P, Adermann K, Ejchart A, Sticht H, Walter S, Schmid FX, Jaenicke R, Forssmann WG, et al.: Structure of human parathyroid hormone 1-37 in solution. J Biol Chem. 1995 Jun 23;270(25):15194-202. [PubMed:7797503 ]
  15. Marx UC, Adermann K, Bayer P, Forssmann WG, Rosch P: Solution structures of human parathyroid hormone fragments hPTH(1-34) and hPTH(1-39) and bovine parathyroid hormone fragment bPTH(1-37). Biochem Biophys Res Commun. 2000 Jan 7;267(1):213-20. [PubMed:10623601 ]
  16. Arnold A, Horst SA, Gardella TJ, Baba H, Levine MA, Kronenberg HM: Mutation of the signal peptide-encoding region of the preproparathyroid hormone gene in familial isolated hypoparathyroidism. J Clin Invest. 1990 Oct;86(4):1084-7. [PubMed:2212001 ]
  17. Sunthornthepvarakul T, Churesigaew S, Ngowngarmratana S: A novel mutation of the signal peptide of the preproparathyroid hormone gene associated with autosomal recessive familial isolated hypoparathyroidism. J Clin Endocrinol Metab. 1999 Oct;84(10):3792-6. [PubMed:10523031 ]
  18. Datta R, Waheed A, Shah GN, Sly WS: Signal sequence mutation in autosomal dominant form of hypoparathyroidism induces apoptosis that is corrected by a chemical chaperone. Proc Natl Acad Sci U S A. 2007 Dec 11;104(50):19989-94. Epub 2007 Dec 3. [PubMed:18056632 ]