You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02136
Secondary Accession Numbers
  • 7619
Name Platelet glycoprotein 4
Synonyms
  1. CD36 antigen
  2. FAT
  3. Fatty acid translocase
  4. GPIIIB
  5. GPIV
  6. Glycoprotein IIIb
  7. Leukocyte differentiation antigen CD36
  8. PAS IV
  9. PAS-4 protein
  10. Platelet collagen receptor
  11. Platelet glycoprotein IV
  12. Thrombospondin receptor
Gene Name CD36
Protein Type Transporter
Biological Properties
General Function Not Available
Specific Function Seems to have numerous potential physiological functions. Binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. May function as a cell adhesion molecule. Directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes. Binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell
Process
cell adhesion
cellular process
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:7
Locus 7q11.2
SNPs CD36
Gene Sequence
>1419 bp
ATGGGCTGTGACCGGAACTGTGGGCTCATCGCTGGGGCTGTCATTGGTGCTGTCCTGGCT
GTGTTTGGAGGTATTCTAATGCCAGTTGGAGACCTGCTTATCCAGAAGACAATTAAAAAG
CAAGTTGTCCTCGAAGAAGGTACAATTGCTTTTAAAAATTGGGTTAAAACAGGCACAGAA
GTTTACAGACAGTTTTGGATCTTTGATGTGCAAAATCCACAGGAAGTGATGATGAACAGC
AGCAACATTCAAGTTAAGCAAAGAGGTCCTTATACGTACAGAGTTCGTTTTCTAGCCAAG
GAAAATGTAACCCAGGACGCTGAGGACAACACAGTCTCTTTCCTGCAGCCCAATGGTGCC
ATCTTCGAACCTTCACTATCAGTTGGAACAGAGGCTGACAACTTCACAGTTCTCAATCTG
GCTGTGGCAGCTGCATCCCATATCTATCAAAATCAATTTGTTCAAATGATCCTCAATTCA
CTTATTAACAAGTCAAAATCTTCTATGTTCCAAGTCAGAACTTTGAGAGAACTGTTATGG
GGCTATAGGGATCCATTTTTGAGTTTGGTTCCGTACCCTGTTACTACCACAGTTGGTCTG
TTTTATCCTTACAACAATACTGCAGATGGAGTTTATAAAGTTTTCAATGGAAAAGATAAC
ATAAGTAAAGTTGCCATAATCGACACATATAAAGGTAAAAGGAATCTGTCCTATTGGGAA
AGTCACTGCGACATGATTAATGGTACAGATGCAGCCTCATTTCCACCTTTTGTTGAGAAA
AGCCAGGTATTGCAGTTCTTTTCTTCTGATATTTGCAGGTCAATCTATGCTGTATTTGAA
TCCGACGTTAATCTGAAAGGAATCCCTGTGTATAGATTTGTTCTTCCATCCAAGGCCTTT
GCCTCTCCAGTTGAAAACCCAGACAACTATTGTTTCTGCACAGAAAAAATTATCTCAAAA
AATTGTACATCATATGGTGTGCTAGACATCAGCAAATGCAAAGAAGGGAGACCTGTGTAC
ATTTCACTTCCTCATTTTCTGTATGCAAGTCCTGATGTTTCAGAACCTATTGATGGATTA
AACCCAAATGAAGAAGAACATAGGACATACTTGGATATTGAACCTATAACTGGATTCACT
TTACAATTTGCAAAACGGCTGCAGGTCAACCTATTGGTCAAGCCATCAGAAAAAATTCAA
GTATTAAAGAATCTGAAGAGGAACTATATTGTGCCTATTCTTTGGCTTAATGAGACTGGG
ACCATTGGTGATGAGAAGGCAAACATGTTCAGAAGTCAAGTAACTGGAAAAATAAACCTC
CTTGGCCTGATAGAAATGATCTTACTCAGTGTTGGTGTGGTGATGTTTGTTGCTTTTATG
ATTTCATATTGTGCATGCAGATCGAAAACAATAAAATAA
Protein Properties
Number of Residues 472
Molecular Weight 53054.0
Theoretical pI 8.06
Pfam Domain Function
Signals
  • 1-23
Transmembrane Regions Not Available
Protein Sequence
>Platelet glycoprotein 4
MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTE
VYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGA
IFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLW
GYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWE
SHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAF
ASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGL
NPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETG
TIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK
GenBank ID Protein 178671
UniProtKB/Swiss-Prot ID P16671
UniProtKB/Swiss-Prot Entry Name CD36_HUMAN
PDB IDs Not Available
GenBank Gene ID M24795
GeneCard ID CD36
GenAtlas ID CD36
HGNC ID HGNC:1663
References
General References
  1. Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. [PubMed:10391209 ]
  2. Oquendo P, Hundt E, Lawler J, Seed B: CD36 directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes. Cell. 1989 Jul 14;58(1):95-101. [PubMed:2473841 ]
  3. Taylor KT, Tang Y, Sobieski DA, Lipsky RH: Characterization of two alternatively spliced 5'-untranslated exons of the human CD36 gene in different cell types. Gene. 1993 Nov 15;133(2):205-12. [PubMed:7693552 ]
  4. Wyler B, Daviet L, Bortkiewicz H, Bordet JC, McGregor JL: Cloning of the cDNA encoding human platelet CD36: comparison to PCR amplified fragments of monocyte, endothelial and HEL cells. Thromb Haemost. 1993 Sep 1;70(3):500-5. [PubMed:7505064 ]
  5. Armesilla AL, Vega MA: Structural organization of the gene for human CD36 glycoprotein. J Biol Chem. 1994 Jul 22;269(29):18985-91. [PubMed:7518447 ]
  6. Tandon NN, Lipsky RH, Burgess WH, Jamieson GA: Isolation and characterization of platelet glycoprotein IV (CD36). J Biol Chem. 1989 May 5;264(13):7570-5. [PubMed:2468669 ]
  7. Gelhaus A, Scheding A, Browne E, Burchard GD, Horstmann RD: Variability of the CD36 gene in West Africa. Hum Mutat. 2001 Nov;18(5):444-50. [PubMed:11668637 ]
  8. Fernandez-Ruiz E, Armesilla AL, Sanchez-Madrid F, Vega MA: Gene encoding the collagen type I and thrombospondin receptor CD36 is located on chromosome 7q11.2. Genomics. 1993 Sep;17(3):759-61. [PubMed:7503937 ]
  9. Tao N, Wagner SJ, Lublin DM: CD36 is palmitoylated on both N- and C-terminal cytoplasmic tails. J Biol Chem. 1996 Sep 13;271(37):22315-20. [PubMed:8798390 ]
  10. Kashiwagi H, Tomiyama Y, Honda S, Kosugi S, Shiraga M, Nagao N, Sekiguchi S, Kanayama Y, Kurata Y, Matsuzawa Y: Molecular basis of CD36 deficiency. Evidence that a 478C-->T substitution (proline90-->serine) in CD36 cDNA accounts for CD36 deficiency. J Clin Invest. 1995 Mar;95(3):1040-6. [PubMed:7533783 ]
  11. Aitman TJ, Cooper LD, Norsworthy PJ, Wahid FN, Gray JK, Curtis BR, McKeigue PM, Kwiatkowski D, Greenwood BM, Snow RW, Hill AV, Scott J: Malaria susceptibility and CD36 mutation. Nature. 2000 Jun 29;405(6790):1015-6. [PubMed:10890433 ]
  12. Hanawa H, Watanabe K, Nakamura T, Ogawa Y, Toba K, Fuse I, Kodama M, Kato K, Fuse K, Aizawa Y: Identification of cryptic splice site, exon skipping, and novel point mutations in type I CD36 deficiency. J Med Genet. 2002 Apr;39(4):286-91. [PubMed:11950861 ]
  13. Omi K, Ohashi J, Patarapotikul J, Hananantachai H, Naka I, Looareesuwan S, Tokunaga K: CD36 polymorphism is associated with protection from cerebral malaria. Am J Hum Genet. 2003 Feb;72(2):364-74. Epub 2002 Dec 27. [PubMed:12506336 ]